Property Summary

NCBI Gene PubMed Count 46
PubMed Score 39.00
PubTator Score 40.05

Knowledge Summary

Patent (7,267)

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.200 3.0e-06
psoriasis 2.100 1.0e-04
glioblastoma multiforme 1.100 1.1e-10
osteosarcoma -1.717 6.2e-06
posterior fossa group A ependymoma 1.600 3.7e-07
intraductal papillary-mucinous adenoma (... 2.700 6.8e-04
intraductal papillary-mucinous carcinoma... 2.100 5.2e-03
lung cancer -1.500 9.1e-03
pilocytic astrocytoma 1.200 1.4e-03
subependymal giant cell astrocytoma 1.731 2.1e-02
ovarian cancer 3.300 1.4e-07
axial spondyloarthropathy 1.100 4.1e-02

Protein-protein Interaction (3)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
25981171 This study showed that LIMK2 messenger RNA levels was significantly upregulated in subjects with schizophrenia in laminar and cellular samples.
25849865 Actin remodelling factor LIMK2 is a key player in the ciliogenesis control network in which YAP/TAZ and directional vesicle trafficking are integral components.
25344584 Results show that in addition to a potential role in promoting metastasis, changes in LIMK1 and LIMK2 expression and/or activity might contribute to AR function in prostate cancer via regulation of microtubule cytoskeletal dynamics.
23991158 results highlight the exciting possibility of combining specific LIMK2 inhibitors with anticancer drugs in the treatment of multi-drug resistant cancers
23585469 LIMK2 expression was reduced in intestinal tumours of cancer-prone mice and in human colorectal cancer cell lines and tumours. LIMK2 expression progressively decreased with advancing stage of colorectal cancer.
23239465 Overexpression of LIMK2 is associated with breast cancer growth and invasiveness.
23082153 Nf1/LIMK2 interaction and inhibition allows to directly connect neurofibromatosis type I to actin cytoskeleton remodeling.
22883572 A novel activity of Rho in promoting a complex between fascin-1 and LIMK1/2 that modulates the interaction of fascin-1 with actin, was identified.
22492986 LIMK2 positively regulates the level of Aurora A, thereby engaging in a positive-feedback loop, promoting Aurora-A-mediated oncogenic pathways.
22328514 LIMK2 is a key regulator that acts through different substrates to provide functional links between the actin cytoskeleton and spindle dynamics.
21321123 Filamin-A-dependent activation of the RhoA-ROCK-LIMK-cofilin pathway is a major event in HIV-1 gp120-induced receptor clustering
21079653 LIMK2 variant isoforms were found to be regulated by p53 through direct interaction with regulatory elements within the LIMK2 gene.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20190821 a novel pathway whereby LIMK2b, acting downstream of p53, ensures proper execution of checkpoint arrest by modulating the dynamics of actin polymerization
20047470 Both LIMK1 and LIMK2 single knock down led to a reduction of invasion and metastatic behavior in the zebrafish xenograft metastasis assay.
20041213 Filamin-A-dependent activation of the RhoA-ROCK-LIMK-cofilin pathway is a major event in HIV-1 gp120-induced receptor clustering
19369647 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of LIM domain kinase 2 (LIMK2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18852895 direct interaction between ROCK1 and LIMK2 in polarised but not blebbing cells; results point to a specific role for the ROCK1:LIMK2 pathway in mesenchymal-mode migration
18000399 gamma-tubulin associates with phosphorylated LIMK1 and LIMK2 but not with dephosphorylated LIMK1 or LIMK2.
17572668 Filamin-A-dependent activation of the RhoA-ROCK-LIMK-cofilin pathway is a major event in HIV-1 gp120-induced receptor clustering
17294230 the structure, regulation and function; possible contributions to human disease (Review)
16820362 analysis of phosphorylation-dependent regulation of unique nuclear and nucleolar localization signals of LIM kinase 2 in endothelial cells
16455074 LIMK2 may play a role different from that of LIMK1 in regulating mitotic spindle organization, chromosome segregation, and cytokinesis during the cell division cycle.
15923181 PKC-mediated exclusion of LIMK2 from the nucleus might be a mechanism to relieve suppression of cyclin D1 expression by LIMK2
15647284 a novel pathway emanating from the TGF-beta type I receptor and leading to regulation of actin assembly, via the kinase LIMK2.

AA Sequence

MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYCPKDYWGKFGE      1 - 70
FCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTE     71 - 140
SVQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTVQVKEVNRMHISPNNRNAIHPGDRILEINGT    141 - 210
PVRTLRVEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLR    211 - 280
RRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTH    281 - 350
KATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSM    351 - 420
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATT    421 - 490
KKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNV    491 - 560
KLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDSFEALSLYLGELGIPLPAELEELDHTVSMQY    561 - 630
GLTRDSPP                                                                  631 - 638
//

Text Mined References (53)

PMID Year Title
25981171 2015 Altered expression of CDC42 signaling pathway components in cortical layer 3 pyramidal cells in schizophrenia.
25849865 2015 Actin remodelling factors control ciliogenesis by regulating YAP/TAZ activity and vesicle trafficking.
25344584 2015 Elevated LIM kinase 1 in nonmetastatic prostate cancer reflects its role in facilitating androgen receptor nuclear translocation.
23991158 2013 LIMK2 mediates resistance to chemotherapeutic drugs in neuroblastoma cells through regulation of drug-induced cell cycle arrest.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23585469 2014 Reduced LIMK2 expression in colorectal cancer reflects its role in limiting stem cell proliferation.
23239465 2013 LIM kinase inhibition reduces breast cancer growth and invasiveness but systemic inhibition does not reduce metastasis in mice.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23082153 2012 Nf1 RasGAP inhibition of LIMK2 mediates a new cross-talk between Ras and Rho pathways.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22883572 2012 A novel Rho-dependent pathway that drives interaction of fascin-1 with p-Lin-11/Isl-1/Mec-3 kinase (LIMK) 1/2 to promote fascin-1/actin binding and filopodia stability.
22492986 2012 LIMK2 is a crucial regulator and effector of Aurora-A-kinase-mediated malignancy.
22328514 2012 TPPP acts downstream of RhoA-ROCK-LIMK2 to regulate astral microtubule organization and spindle orientation.
21150874 2011 A genome-wide association study for diabetic nephropathy genes in African Americans.
21079653 2011 p53-mediated transcriptional regulation and activation of the actin cytoskeleton regulatory RhoC to LIMK2 signaling pathway promotes cell survival.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20190821 2010 p53-Mediated transactivation of LIMK2b links actin dynamics to cell cycle checkpoint control.
20047470 2009 LIMK1 and LIMK2 are important for metastatic behavior and tumor cell-induced angiogenesis of pancreatic cancer cells.
19369647 2009 Identification of potentially damaging amino acid substitutions leading to human male infertility.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18852895 2008 ROCK1 and LIMK2 interact in spread but not blebbing cancer cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18000399 2007 Phosphorylated LIM kinases colocalize with gamma-tubulin in centrosomes during early stages of mitosis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17294230 2007 LIM kinases: function, regulation and association with human disease.
16820362 2006 Phosphorylation-dependent regulation of unique nuclear and nucleolar localization signals of LIM kinase 2 in endothelial cells.
16505165 2006 Par-3 mediates the inhibition of LIM kinase 2 to regulate cofilin phosphorylation and tight junction assembly.
16455074 2006 Different activity regulation and subcellular localization of LIMK1 and LIMK2 during cell cycle transition.
16381901 2006 The LIFEdb database in 2006.
15923181 2005 Inhibition of nuclear import of LIMK2 in endothelial cells by protein kinase C-dependent phosphorylation at Ser-283.
15647284 2005 LIM-kinase 2 and cofilin phosphorylation mediate actin cytoskeleton reorganization induced by transforming growth factor-beta.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11418599 2001 Cofilin phosphorylation and actin reorganization activities of testicular protein kinase 2 and its predominant expression in testicular Sertoli cells.
11340065 2001 Activation of LIM kinases by myotonic dystrophy kinase-related Cdc42-binding kinase alpha.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11171090 2001 LIM-kinase 2 induces formation of stress fibres, focal adhesions and membrane blebs, dependent on its activation by Rho-associated kinase-catalysed phosphorylation at threonine-505.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11018042 2001 Specific activation of LIM kinase 2 via phosphorylation of threonine 505 by ROCK, a Rho-dependent protein kinase.
10613909 1999 Cofilin phosphorylation and actin cytoskeletal dynamics regulated by rho- and Cdc42-activated LIM-kinase 2.
10591208 1999 The DNA sequence of human chromosome 22.
10452946 1999 Cloning and characterization of the alternative promoter regions of the human LIMK2 gene responsible for alternative transcripts with tissue-specific expression.
10436159 1999 Signaling from Rho to the actin cytoskeleton through protein kinases ROCK and LIM-kinase.
9655398 1998 Cofilin phosphorylation by LIM-kinase 1 and its role in Rac-mediated actin reorganization.
8980133 1996 Self-association of LIM-kinase 1 mediated by the interaction between an N-terminal LIM domain and a C-terminal kinase domain.
8954941 1996 Subcellular localization and protein interaction of the human LIMK2 gene expressing alternative transcripts with tissue-specific regulation.
8537403 1995 Identification and characterization of a novel family of serine/threonine kinases containing two N-terminal LIM motifs.