Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.30
PubTator Score 12.41

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
22395814 these results establish LIME as a transmembrane adaptor protein linking TCR stimulation to IS formation and integrin activation through activation of Vav(Vav guanine nucleotide exchange factor)

AA Sequence

MGLPVSWAPPALWVLGCCALLLSLWALCTACRRPEDAVAPRKRARRQRARLQGSATAAEASLLRRTHLCS      1 - 70
LSKSDTRLHELHRGPRSSRALRPASMDLLRPHWLEVSRDITGPQAAPSAFPHQELPRALPAAAATAGCAG     71 - 140
LEATYSNVGLAALPGVSLAASPVVAEYARVQKRKGTHRSPQEPQQGKTEVTPAAQVDVLYSRVCKPKRRD    141 - 210
PGPTTDPLDPKGQGAILALAGDLAYQTLPLRALDVDSGPLENVYESIRELGDPAGRSSTCGAGTPPASSC    211 - 280
PSLGRGWRPLPASLP                                                           281 - 295
//

Text Mined References (17)

PMID Year Title
24870542 2014 A draft map of the human proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22395814 2012 LIME mediates immunological synapse formation through activation of VAV.
17437027 2007 Novel peptide identification from tandem mass spectra using ESTs and sequence database compression.
16249387 2006 LIME acts as a transmembrane adapter mediating BCR-dependent B-cell activation.
16160011 2006 Transmembrane adaptor molecules: a new category of lymphoid-cell markers.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14610046 2003 LIME: a new membrane Raft-associated adaptor protein involved in CD4 and CD8 coreceptor signaling.
14610044 2003 LIME, a novel transmembrane adaptor protein, associates with p56lck and mediates T cell activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.