Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.66
PubTator Score 0.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
interstitial lung disease -1.400 1.6e-03
psoriasis -1.400 4.3e-03
osteosarcoma 1.539 3.3e-02
glioblastoma -1.400 4.2e-02
group 3 medulloblastoma -2.000 1.9e-04
atypical teratoid / rhabdoid tumor -2.000 1.4e-02
medulloblastoma, large-cell -2.000 2.5e-04
primitive neuroectodermal tumor -1.100 3.6e-02
hereditary spastic paraplegia -1.233 5.7e-03
Amyotrophic Lateral Sclerosis 1.180 5.9e-06
adrenocortical carcinoma -1.796 2.0e-03
non-small cell lung cancer -3.588 9.5e-24
X-linked cerebral adrenoleukodystrophy 1.600 4.7e-02
lung cancer -6.700 3.1e-07
active Crohn's disease 1.740 6.4e-03
active ulcerative colitis 1.604 2.4e-02
breast carcinoma -1.600 1.4e-04
Breast cancer 3.100 3.7e-02
interstitial cystitis -1.500 6.8e-05
cystic fibrosis -2.200 1.4e-04
lung adenocarcinoma -2.600 6.4e-11
pediatric high grade glioma -1.500 4.7e-05
pilocytic astrocytoma -1.300 5.5e-07
lung carcinoma -1.200 1.3e-12
Pick disease -1.200 2.0e-03
progressive supranuclear palsy -1.100 8.7e-03
invasive ductal carcinoma -2.100 1.6e-02
ovarian cancer -2.100 1.3e-05
Down syndrome 1.300 7.8e-04
dermatomyositis 1.200 7.4e-03

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MACPALGLEALQPLQPEPPPEPAFSEAQKWIEQVTGRSFGDKDFRTGLENGILLCELLNAIKPGLVKKIN      1 - 70
RLPTPIAGLDNIILFLRGCKELGLKESQLFDPSDLQDTSNRVTVKSLDYSRKLKNVLVTIYWLGKAANSC     71 - 140
TSYSGTTLNLKEFEGLLAQMRKDTDDIESPKRSIRDSGYIDCWDSERSDSLSPPRHGRDDSFDSLDSFGS    141 - 210
RSRQTPSPDVVLRGSSDGRGSDSESDLPHRKLPDVKKDDMSARRTSHGEPKSAVPFNQYLPNKSNQTAYV    211 - 280
PAPLRKKKAEREEYRKSWSTATSPLGGERPFRYGPRTPVSDDAESTSMFDMRCEEEAAVQPHSRARQEQL    281 - 350
QLINNQLREEDDKWQDDLARWKSRRRSVSQDLIKKEEERKKMEKLLAGEDGTSERRKSIKTYREIVQEKE    351 - 420
RRERELHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLR    421 - 490
QQSLPPPKFTATVETTIARASVLDTSMSAGSGSPSKTVTPKAVPMLTPKPYSQPKNSQDVLKTFKVDGKV    491 - 560
SVNGETVHREEEKERECPTVAPAHSLTKSQMFEGVARVHGSPLELKQDNGSIEINIKKPNSVPQELAATT    561 - 630
EKTEPNSQEDKNDGGKSRKGNIELASSEPQHFTTTVTRCSPTVAFVEFPSSPQLKNDVSEEKDQKKPENE    631 - 700
MSGKVELVLSQKVVKPKSPEPEATLTFPFLDKMPEANQLHLPNLNSQVDSPSSEKSPVMTPQFKFWAWDP    701 - 770
EEERRRQEKWQQEQERLLQERYQKEQDKLKEEWEKAQKEVEEEERRYYEEERKIIEDTVVPFTVSSSSAD    771 - 840
QLSTSSSMTEGSGTMNKIDLGNCQDEKQDRRWKKSFQGDDSDLLLKTRESDRLEEKGSLTEGALAHSGNP    841 - 910
VSKGVHEDHQLDTEAGAPHCGTNPQLAQDPSQNQQTSNPTHSSEDVKPKTLPLDKSINHQIESPSERRKK    911 - 980
SPREHFQAGPFSPCSPTPPGQSPNRSISGKKLCSSCGLPLGKGAAMIIETLNLYFHIQCFRCGICKGQLG    981 - 1050
DAVSGTDVRIRNGLLNCNDCYMRSRSAGQPTTL                                        1051 - 1083
//

Text Mined References (28)

PMID Year Title
25350695 2014 Pharmacogenetic meta-analysis of genome-wide association studies of LDL cholesterol response to statins.
25199915 2015 GWAS of longevity in CHARGE consortium confirms APOE and FOXO3 candidacy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9847074 1998 Toward a complete human genome sequence.