Property Summary

NCBI Gene PubMed Count 34
PubMed Score 22.92
PubTator Score 29.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.400 2.6e-02
urothelial carcinoma -1.200 4.3e-02
astrocytic glioma 1.400 1.8e-02
oligodendroglioma 1.700 3.4e-02
Barrett's esophagus 1.400 1.4e-02
esophageal adenocarcinoma 1.200 2.1e-02
glioblastoma 2.600 3.9e-04
osteosarcoma 1.307 1.3e-02
medulloblastoma, large-cell -1.500 3.8e-02
juvenile dermatomyositis 1.745 7.8e-12
Amyotrophic Lateral Sclerosis 1.071 2.1e-05
primary pancreatic ductal adenocarcinoma 2.001 2.2e-03
intraductal papillary-mucinous adenoma (... 2.800 1.1e-03
intraductal papillary-mucinous carcinoma... 2.100 2.5e-03
intraductal papillary-mucinous neoplasm ... 2.600 1.7e-02
lung cancer -1.800 2.0e-05
interstitial cystitis -1.100 6.2e-04
pediatric high grade glioma 2.100 2.4e-05
pilocytic astrocytoma 2.100 3.1e-06
ovarian cancer -3.400 6.6e-17
pancreatic cancer 1.400 2.5e-02

Gene RIF (11)

PMID Text
26350886 EPLIN is functionally linked to molecules like actin and paxillin and has been implicated in a number of potential pathways to enhance metastatic potential
25496916 LIM domain and actin binding 1 (LIMA1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24135282 a major activity of DNp73 is to establish initiation of the invasion-metastasis cascade via EPLIN-dependent IGF1R regulation
23188829 EGF promotes epithelial-mesenchymal transition and induces degradation of EPLIN, a putative suppressor of prostate cancer metastasis.
22493360 Together with the findings that EPLIN-alpha inhibits cellular growth and invasion, we conclude that EPLIN-alpha is a tumour suppressor of oesophageal cancer
22194609 EPLIN clutch is necessary for stabilization of capillary structures in an angiogenesis model.
21625216 EPLIN downregulation promotes epithelial-mesenchymal transition in prostate cancer cells and correlates with clinical lymph node metastasis.
20848180 EPLINalpha over-expression can regulate HECV cell motility, matrix adhesion and tubule formation in vitro and slow in vivo tumour formation, suggesting an anti-angiogenic role for EPLINalpha.
19221476 EPLIN protein may function during cytokinesis to maintain local accumulation of key cytokinesis proteins at the furrow.
18796137 expression of EPLIN-alpha in breast cancer is down-regulated in breast cancer cells .
18093941 EPLIN functions to link the cadherin-catenin complex to F-actin and simultaneously stabilizes this population of actin fibers, resulting in the establishment of the adhesion

AA Sequence

MESSPFNRRQWTSLSLRVTAKELSLVNKNKSSAIVEIFSKYQKAAEETNMEKKRSNTENLSQHFRKGTLT      1 - 70
VLKKKWENPGLGAESHTDSLRNSSTEIRHRADHPPAEVTSHAASGAKADQEEQIHPRSRLRSPPEALVQG     71 - 140
RYPHIKDGEDLKDHSTESKKMENCLGESRHEVEKSEISENTDASGKIEKYNVPLNRLKMMFEKGEPTQTK    141 - 210
ILRAQSRSASGRKISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELPRLSETSIKDRMAKYQAAVSK    211 - 280
QSSSTNYTNELKASGGEIKIHKMEQKENVPPGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDSQVKS    281 - 350
EVQQPVHPKPLSPDSRASSLSESSPPKAMKKFQAPARETCVECQKTVYPMERLLANQQVFHISCFRCSYC    351 - 420
NNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHRPHKDLWASKNENEEILERPAQLANARETPHS    421 - 490
PGVEDAPIAKVGVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGIKMSKPKWPPED    491 - 560
EISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASFQSTSVKSPKTVSPPIRKGWSMSEQSEESVGGRV    561 - 630
AERKQVENAKASKKNGNVGKTTWQNKESKGETGKRSKEGHSLEMENENLVENGADSDEDDNSFLKQQSPQ    631 - 700
EPKSLNWSSFVDNTFAEEFTTQNQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE               701 - 759
//

Text Mined References (46)

PMID Year Title
26350886 2015 EPLIN: a fundamental actin regulator in cancer metastasis?
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24135282 2013 DNp73 exerts function in metastasis initiation by disconnecting the inhibitory role of EPLIN on IGF1R-AKT/STAT3 signaling.
23188829 2013 Epidermal growth factor promotes protein degradation of epithelial protein lost in neoplasm (EPLIN), a putative metastasis suppressor, during epithelial-mesenchymal transition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22493360 2012 EPLIN-? expression in human oesophageal cancer and its impact on cellular aggressiveness and clinical outcome.
22194609 2012 Epithelial protein lost in neoplasm (EPLIN) interacts with ?-catenin and actin filaments in endothelial cells and stabilizes vascular capillary network in vitro.
21625216 2011 EPLIN downregulation promotes epithelial-mesenchymal transition in prostate cancer cells and correlates with clinical lymph node metastasis.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20848180 2010 The impact of EPLIN? (Epithelial protein lost in neoplasm) on endothelial cells, angiogenesis and tumorigenesis.
20309963 2010 Novel interactors and a role for supervillin in early cytokinesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19221476 2009 The actin-binding and bundling protein, EPLIN, is required for cytokinesis.
18796137 2008 Eplin-alpha expression in human breast cancer, the impact on cellular migration and clinical outcome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18093941 2008 EPLIN mediates linkage of the cadherin catenin complex to F-actin and stabilizes the circumferential actin belt.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12566430 2003 EPLIN regulates actin dynamics by cross-linking and stabilizing filaments.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10806352 2000 Characterization of the human EPLIN (Epithelial Protein Lost in Neoplasm) gene reveals distinct promoters for the two EPLIN isoforms.
10618726 1999 EPLIN, epithelial protein lost in neoplasm.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.