Property Summary

NCBI Gene PubMed Count 16
PubMed Score 52.22
PubTator Score 54.28

Knowledge Summary

Patent

No data available

Gene RIF (6)

AA Sequence

MYSFMGGGLFCAWVGTILLVVAMATDHWMQYRLSGSFAHQGLWRYCLGNKCYLQTDSIAYWNATRAFMIL      1 - 70
SALCAISGIIMGIMAFAHQPTFSRISRPFSAGIMFFSSTLFVVLALAIYTGVTVSFLGRRFGDWRFSWSY     71 - 140
ILGWVAVLMTFFAGIFYMCAYRVHECRRLSTPR                                         141 - 173
//

Text Mined References (17)

PMID Year Title