Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 2.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.8e-08
colon cancer 1478 1.1e-03
ductal carcinoma in situ 1745 2.6e-03
invasive ductal carcinoma 2951 8.7e-03
fibroadenoma 559 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.200 1.1e-03
ductal carcinoma in situ -1.800 2.6e-03
fibroadenoma -1.900 1.8e-02
invasive ductal carcinoma -1.900 8.7e-03
osteosarcoma -3.102 1.8e-08

Gene RIF (5)

AA Sequence

MTLTLSVLICLGLSVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARK      1 - 70
RQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNV     71 - 140
TLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPS    141 - 210
DLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANF    211 - 280
TLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQI    281 - 350
DTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGP    351 - 420
SGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGVVTGVSVAFVLLLFLLLFLLLRHRHQSKHRTS    421 - 490
AHFYRPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAAASEAPQDVTYAQLHSL    491 - 560
TLRREATEPPPSQEREPPAEPSIYAPLAIH                                            561 - 590
//

Text Mined References (13)

PMID Year Title