Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 2.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
osteosarcoma 7933 1.8e-08
colon cancer 1475 1.1e-03
ductal carcinoma in situ 1745 2.6e-03
invasive ductal carcinoma 2950 8.7e-03
fibroadenoma 557 1.8e-02

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -3.102 1.8e-08
colon cancer -1.200 1.1e-03
fibroadenoma -1.900 1.8e-02
ductal carcinoma in situ -1.800 2.6e-03
invasive ductal carcinoma -1.900 8.7e-03

Gene RIF (4)

PMID Text
26098415 LILRB5 binding to intracellular HLA-class I heavy chains suggests a chaperone function
25214527 The rs12975366 in the LILRB5 gene was significantly associated with CK levels of statin users.
20237496 Observational study of gene-disease association. (HuGE Navigator)
17998301 Mature cord-blood-derived mast cells expressed LILRB5 in cytoplasmic granules and upon cross-linking of the high-affinity IgE receptor, released LILRB5 into the culture medium.

AA Sequence

MTLTLSVLICLGLSVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARK      1 - 70
RQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNV     71 - 140
TLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPS    141 - 210
DLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANF    211 - 280
TLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQI    281 - 350
DTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGP    351 - 420
SGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGVVTGVSVAFVLLLFLLLFLLLRHRHQSKHRTS    421 - 490
AHFYRPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAAASEAPQDVTYAQLHSL    491 - 560
TLRREATEPPPSQEREPPAEPSIYAPLAIH                                            561 - 590
//

Text Mined References (12)

PMID Year Title
26098415 2015 The Leukocyte Immunoglobulin-Like Receptor Family Member LILRB5 Binds to HLA-Class I Heavy Chains.
25214527 2014 CKM and LILRB5 are associated with serum levels of creatine kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17998301 2008 Differential expression of leukocyte immunoglobulin-like receptors on cord-blood-derived human mast cell progenitors and mature mast cells.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9548455 1997 A family of human lymphoid and myeloid Ig-like receptors, some of which bind to MHC class I molecules.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.