Property Summary

NCBI Gene PubMed Count 52
PubMed Score 47.75
PubTator Score 56.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 2.200 1.7e-03
osteosarcoma -1.103 3.5e-02
tuberculosis and treatment for 6 months -1.300 3.3e-04
interstitial cystitis 1.600 1.4e-03
invasive ductal carcinoma 1.012 4.4e-04
lung carcinoma -1.100 9.0e-07
head and neck cancer and chronic obstruc... 1.100 8.6e-04
psoriasis 1.300 2.8e-33

Gene RIF (21)

PMID Text
26678451 Identification of ILT4 as a cellular receptor for CSP C4d
25551576 involvement of ILT3 and ILT4 in the modulation of immune responsiveness in multiple sclerosis by both interferon and vitamin D
22664025 Cyclosporine up-regulated the expression of ILT3 and ILT4 on natural killer cells, which influenced their cytotoxicity against tumor cells.
22387553 ILT3Fc inhibits T cell activation and induces the generation of suppressor T cells targeting multiple inflammatory miRNA pathways.
21454581 Crystal structure of leukocyte Ig-like receptor LILRB4 (ILT3/LIR-5/CD85k): a myeloid inhibitory receptor involved in immune tolerance.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19860908 upregulated on antigen-presenting cells in response to Salmonella infection
19833736 Data show that LILRB4 is a potent inhibitor of monocyte activation via FcgammaRI.
19535644 A tryptophan-deprived environment generates monocyte-derived dendritic cells with a marked up-regulation of inhibitory receptors ILT3 and ILT4 and enhanced capacity to induce CD4+CD25+Foxp3+ regulatory T cells in an ILT3-dependent manner.
19380766 ILT3 may play a critical role in the control of inflammation.
19010139 A significant association is observed between ILT3 dendritic cells in kidney transplants and donor age.
18802077 Expressed on cultured osteoclast precursor cells derived from peripheral blood monocytes; could be inhibitory for osteoclast development in presence of receptor activator of NF-kappaB ligand (RANKL) and macrophage colony stimulating factor (M-CSF).
18486764 15 single nucleotide polymorphisms are identified in the extracellular domain of immunoglobulin-like transcript 3 gene from healthy individuals.
18420485 ILT3-Fc is a potent immunoregulatory agent that suppresses islet allograft rejection in humanized NOD/SCID mice.
17998301 Progenitor mast cells expressed cell surface inhibitory LILRB4. Mature cord-blood-derived mast cells had detectable mRNA encoding multiple LILRs, none were expressed on the cell surface.
17993722 describe an immune-escape mechanism mediated by the inhibitory receptor immunoglobulin-like transcript 3 (ILT3) which may be responsible for failure of pancreatic cancer therapy
17923119 Both membrane and soluble ILT3 are proteins with potent immunosuppressive activity which are of importance for treatment of rejection, autoimmunity and cancer.
17513794 The inhibitory effect of serum and membrane ILT3 in a humanized SCID mouse model describes an immune-escape mechanism that could contribute to impaired T cell responses in patients with cancer.
17266150 Our findings indicate that expression of ILT3 and ILT4 on CLL B cells represents a phenotypic abnormality that may play a role in tolerization of tumor-specific T cells.
16433759 ILT3 precursor RNA is expressed and retained in nuclei of resting endothelial cells.
15670976 report that ILT2 receptor, ILT3 receptor, ILT4 receptor, and KIR2DL4 receptor expression is up-regulated by HLA-G histocompatibility antigen in antigen-presenting cells, natural killer cells, and T cells

AA Sequence

MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRLDKEESPAPWD      1 - 70
RQNPLEPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSV     71 - 140
TLLCQSRSPMDTFLLIKERAAHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPS    141 - 210
DPLELIVSGSLEDPRPSPTRSVSTAAGPEDQPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLL    211 - 280
QHWRQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSP    281 - 350
HDEDPQAVTYAKVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSFTL    351 - 420
RQKATEPPPSQEGASPAEPSVYATLAIH                                              421 - 448
//

Text Mined References (54)

PMID Year Title
26678451 2016 Ig-like transcript 4 as a cellular receptor for soluble complement fragment C4d.
25551576 2014 Interferon beta and vitamin D synergize to induce immunoregulatory receptors on peripheral blood monocytes of multiple sclerosis patients.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666960 2013 Plasmacytoid dendritic cells in patients with autoimmune thyroid disease.
23616249 2013 Mesenchymal stem cells from periapical lesions modulate differentiation and functional properties of monocyte-derived dendritic cells.
23607934 2013 Lost therapeutic potential of monocyte-derived dendritic cells through lost tissue homing: stable restoration of gut specificity with retinoic acid.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23039892 2012 Dysregulated immunophenotypic attributes of plasmacytoid but not myeloid dendritic cells in HIV-1 infected individuals in the absence of highly active anti-retroviral therapy.
23027709 Expression of immune inhibitory receptor ILT3 in acute myeloid leukemia with monocytic differentiation.
23018130 2012 Induction of antigen-specific human T suppressor cells by membrane and soluble ILT3.
22904259 2013 Functional genetic polymorphisms in ILT3 are associated with decreased surface expression on dendritic cells and increased serum cytokines in lupus patients.
22767507 2012 Human mesenchymal stem cells shift CD8+ T cells towards a suppressive phenotype by inducing tolerogenic monocytes.
22664025 2012 Cyclosporine induces up-regulation of immunoglobulin-like transcripts 3 and 4 expression on and activity of NKL cells.
22387553 2012 Downregulation of inflammatory microRNAs by Ig-like transcript 3 is essential for the differentiation of human CD8(+) T suppressor cells.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
21454581 2011 Crystal structure of leukocyte Ig-like receptor LILRB4 (ILT3/LIR-5/CD85k): a myeloid inhibitory receptor involved in immune tolerance.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19860908 2009 The inhibitory receptor LILRB4 (ILT3) modulates antigen presenting cell phenotype and, along with LILRB2 (ILT4), is upregulated in response to Salmonella infection.
19833736 2009 Leukocyte Ig-like receptor B4 (LILRB4) is a potent inhibitor of FcgammaRI-mediated monocyte activation via dephosphorylation of multiple kinases.
19658091 2009 Alternative mRNA splicing creates transcripts encoding soluble proteins from most LILR genes.
19561330 2009 Inhibition of mitochondrial fission favours mutant over wild-type mitochondrial DNA.
19535644 2009 Tryptophan deprivation induces inhibitory receptors ILT3 and ILT4 on dendritic cells favoring the induction of human CD4+CD25+ Foxp3+ T regulatory cells.
19380766 2009 Ig-like transcript 3 regulates expression of proinflammatory cytokines and migration of activated T cells.
19010139 2008 Changes in the expression of the immunoglobulin-like transcript 3 (ILT3) and ILT4 receptors in renal allograft recipients: effect of donor and recipient aging.
18802077 2008 Inhibitory immunoglobulin-like receptors LILRB and PIR-B negatively regulate osteoclast development.
18486764 Polymorphism and linkage disequilibrium of immunoglobulin-like transcript 3 gene.
18420485 2008 Immunoglobulin-like transcript 3-Fc suppresses T-cell responses to allogeneic human islet transplants in hu-NOD/SCID mice.
17998301 2008 Differential expression of leukocyte immunoglobulin-like receptors on cord-blood-derived human mast cell progenitors and mature mast cells.
17993722 2007 Pancreas cancer and the role of soluble immunoglobulin-like transcript 3 (ILT3).
17923119 2007 Central role of ILT3 in the T suppressor cell cascade.
17513794 2007 Soluble Ig-like transcript 3 inhibits tumor allograft rejection in humanized SCID mice and T cell responses in cancer patients.
17266150 2007 Expression of inhibitory receptor ILT3 on neoplastic B cells is associated with lymphoid tissue involvement in chronic lymphocytic leukemia.
17161342 2006 Immunosuppressive activity of recombinant ILT3.
16493035 2006 Recombinant Ig-like transcript 3-Fc modulates T cell responses via induction of Th anergy and differentiation of CD8+ T suppressor cells.
16433759 2006 Regulation of ILT3 gene expression by processing of precursor transcripts in human endothelial cells.
16406677 2006 Expression, purification, and refolding of the myeloid inhibitory receptor leukocyte immunoglobulin-like receptor-5 for structural and ligand identification studies.
15670976 2005 HLA-G up-regulates ILT2, ILT3, ILT4, and KIR2DL4 in antigen presenting cells, NK cells, and T cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11875462 2002 Tolerization of dendritic cells by T(S) cells: the crucial role of inhibitory receptors ILT3 and ILT4.
11491530 Conserved organization of the ILT/LIR gene family within the polymorphic human leukocyte receptor complex.
10941837 2000 Genomic organization of the human leukocyte immunoglobulin-like receptors within the leukocyte receptor complex on chromosome 19q13.4.
10940079 2000 Common polymorphisms and alternative splicing in the ILT3 gene are not associated with atopy.
10781084 2000 Plasticity in the organization and sequences of human KIR/ILT gene families.
9862332 1998 Isotypic variation of novel immunoglobulin-like transcript/killer cell inhibitory receptor loci in the leukocyte receptor complex.
9786947 1998 A human dynamin-related protein controls the distribution of mitochondria.
9548455 1997 A family of human lymphoid and myeloid Ig-like receptors, some of which bind to MHC class I molecules.
9278324 1997 Molecular identification of a novel family of human Ig superfamily members that possess immunoreceptor tyrosine-based inhibition motifs and homology to the mouse gp49B1 inhibitory receptor.
9151699 1997 A novel inhibitory receptor (ILT3) expressed on monocytes, macrophages, and dendritic cells involved in antigen processing.
9079806 1997 Cloning of novel immunoglobulin superfamily receptors expressed on human myeloid and lymphoid cells: structural evidence for new stimulatory and inhibitory pathways.