Property Summary

NCBI Gene PubMed Count 9
PubMed Score 22.37
PubTator Score 9.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2844 4.0e-20
mucosa-associated lymphoid tissue lymphoma 480 6.4e-03
Disease Target Count Z-score Confidence
Takayasu's arteritis 54 3.53 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -1.600 4.0e-20
mucosa-associated lymphoid tissue lympho... 1.470 6.4e-03

Gene RIF (3)

PMID Text
24096970 LILRA6 copy number variation may influence the level of the activating receptor on the cell surface, potentially affecting signaling upon LILRB3/A6 ligation
20331378 Observational study of gene-disease association. (HuGE Navigator)
19617579 Allogeneic disparities in immunoglobulin-like transcript 5 induce potent antibody responses in hematopoietic stem cell transplant recipients

AA Sequence

MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLD      1 - 70
RNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNM     71 - 140
TLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHP    141 - 210
SDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQAN    211 - 280
FTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGY    281 - 350
FDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSG    351 - 420
HSGGSSLPPTGPPSTPASHAKDYTVENLIRMGMAGLVLVFLGILLFEAQHSQRNPQDAAGR             421 - 481
//

Text Mined References (9)

PMID Year Title
24096970 2014 Diversity of the human LILRB3/A6 locus encoding a myeloid inhibitory and activating receptor pair.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19617579 2009 Allogeneic disparities in immunoglobulin-like transcript 5 induce potent antibody responses in hematopoietic stem cell transplant recipients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10941842 2000 Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.