Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.22
PubTator Score 12.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
chronic lymphocytic leukemia 244
Disease Target Count P-value
psoriasis 6685 1.3e-29
osteosarcoma 7933 4.1e-09
ovarian cancer 8491 3.5e-05
cutaneous lupus erythematosus 1056 5.1e-04

Expression

  Differential Expression (5)

Disease log2 FC p
chronic lymphocytic leukemia 1.573 2.2e-02
cutaneous lupus erythematosus 2.900 5.1e-04
osteosarcoma -1.868 4.1e-09
ovarian cancer -1.300 3.5e-05
psoriasis 1.700 1.3e-29

Gene RIF (10)

PMID Text
26172439 Vpu-mediated suppresion of IFN-1 production requires engagement and activation of the LILRA4 (ILT7) plasmacytoid dendritic cell receptor by BST2
24586760 Crosslinked ILT7 favours the differentiation of immature plasmacytoid dendritic cells into antigen-presenting cells rather than IPC.
23401591 ILT7 may exert its immunomodulatory activity only on immature circulating plasmacytoid dendritic cells (pDCs), providing a basic homeostatic mechanism rather than negative feedback control on activated pDCs.
22674796 Intracellular expression of the TCL1 as well as membrane and intracellular expression of ILT7 in plasmacytoid dendritic cell leukemia (pDCL) samples and 61 non-pDC acute leukemia samples, were tested.
20331378 Observational study of gene-disease association. (HuGE Navigator)
19564354 Data show that BST2 directly binds to purified ILT7, initiates signaling via the ILT7-FcepsilonRIgamma complex, and regulates TLR7/9 responses in plasmacytoid dendritic cells.
18048391 key regulator of human pDC function and interferon type I production.
18006695 Observational study of gene-disease association. (HuGE Navigator)
16735691 ILT7 protein associates with the signal adapter protein Fc epsilonRI gamma to form a receptor complex in dendritic cells.
12384430 the expression of immunoglobulin-like transcript 7, in plasmacytoid dendritic cells

AA Sequence

MTLILTSLLFFGLSLGPRTRVQAENLPKPILWAEPGPVITWHNPVTIWCQGTLEAQGYRLDKEGNSMSRH      1 - 70
ILKTLESENKVKLSIPSMMWEHAGRYHCYYQSPAGWSEPSDPLELVVTAYSRPTLSALPSPVVTSGVNVT     71 - 140
LRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPS    141 - 210
DPLQLLVSGVSRKPSLLTLQGPVVTPGENLTLQCGSDVGYIRYTLYKEGADGLPQRPGRQPQAGLSQANF    211 - 280
TLSPVSRSYGGQYRCYGAHNVSSEWSAPSDPLDILIAGQISDRPSLSVQPGPTVTSGEKVTLLCQSWDPM    281 - 350
FTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSRSSNPYLLSHPSEPLELVVSGA    351 - 420
TETLNPAQKKSDSKTAPHLQDYTVENLIRMGVAGLVLLFLGILLFEAQHSQRSPPRCSQEANSRKDNAPF    421 - 490
RVVEPWEQI                                                                 491 - 499
//

Text Mined References (19)

PMID Year Title
24586760 2014 Effect of immunoglobin-like transcript 7 cross-linking on plasmacytoid dendritic cells differentiation into antigen-presenting cells.
23401591 2013 Ig-like transcript 7, but not bone marrow stromal cell antigen 2 (also known as HM1.24, tetherin, or CD317), modulates plasmacytoid dendritic cell function in primary human blood leukocytes.
22674796 2012 Intracytoplasmic detection of TCL1--but not ILT7-by flow cytometry is useful for blastic plasmacytoid dendritic cell leukemia diagnosis.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20193018 2010 Signaling and ligand interaction of ILT7: receptor-mediated regulatory mechanisms for plasmacytoid dendritic cells.
19723650 2009 Impairment of plasmacytoid dendritic cells for IFN production by the ligand for immunoglobulin-like transcript 7 expressed on human cancer cells.
19564354 2009 Regulation of TLR7/9 responses in plasmacytoid dendritic cells by BST2 and ILT7 receptor interaction.
18048391 2008 SAGE library screening reveals ILT7 as a specific plasmacytoid dendritic cell marker that regulates type I IFN production.
18006695 2008 Scan of 977 nonsynonymous SNPs in CLL4 trial patients for the identification of genetic variants influencing prognosis.
16777052 2006 Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry.
16735691 2006 Plasmacytoid dendritic cell-specific receptor ILT7-Fc epsilonRI gamma inhibits Toll-like receptor-induced interferon production.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15094202 2004 Immunoglobulin-like transcripts ILT2, ILT3 and ILT7 are expressed by human dendritic cells and down-regulated following activation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12529506 2003 Activation of human eosinophils through leukocyte immunoglobulin-like receptor 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384430 2002 Subtractive hybridization reveals the expression of immunoglobulin-like transcript 7, Eph-B1, granzyme B, and 3 novel transcripts in human plasmacytoid dendritic cells.
11491530 Conserved organization of the ILT/LIR gene family within the polymorphic human leukocyte receptor complex.
10941842 2000 Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.