Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.34
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count P-value
lung carcinoma 2843 9.6e-19
osteosarcoma 7950 1.9e-05
tuberculosis 2010 2.4e-05
lung cancer 4740 5.2e-04
Rheumatoid arthritis 1191 1.5e-02
cutaneous lupus erythematosus 1057 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 1.6e-02
lung cancer -1.400 5.2e-04
lung carcinoma -1.500 9.6e-19
osteosarcoma -1.346 1.9e-05
Rheumatoid arthritis -1.400 1.5e-02
tuberculosis 1.400 2.4e-05

Gene RIF (2)

AA Sequence

MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWI      1 - 70
TRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGN     71 - 140
VTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSL    141 - 210
PSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQA    211 - 280
NFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWG    281 - 350
PFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS    351 - 420
GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLFEAQHSQRSL     421 - 489
//

Text Mined References (19)

PMID Year Title