Property Summary

NCBI Gene PubMed Count 69
PubMed Score 212.16
PubTator Score 110.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
cold-induced sweating syndrome 6 5.146 2.6
Leukocoria 7 3.024 1.5
Disease Target Count
STUVE-WIEDEMANN SYNDROME 1
Disease Target Count
Stueve-Wiedemann syndrome 1

Expression

  Differential Expression (32)

Disease log2 FC p
interstitial lung disease -1.300 4.6e-02
malignant mesothelioma -3.800 1.1e-08
ependymoma 2.500 1.1e-02
oligodendroglioma 2.100 3.8e-02
psoriasis -2.200 1.4e-08
astrocytoma 1.600 1.0e-09
osteosarcoma 3.027 7.2e-04
group 3 medulloblastoma -1.900 9.7e-03
glioblastoma 1.300 1.1e-02
medulloblastoma, large-cell -1.900 1.5e-05
adrenocortical carcinoma -1.633 7.5e-03
pancreatic ductal adenocarcinoma liver m... -2.537 4.2e-04
non-small cell lung cancer -2.594 9.3e-17
intraductal papillary-mucinous adenoma (... -1.700 2.6e-02
intraductal papillary-mucinous carcinoma... -3.100 9.7e-03
intraductal papillary-mucinous neoplasm ... -2.800 1.2e-02
Hydrolethalus syndrome 1.051 4.6e-02
lung cancer -5.300 2.7e-07
colon cancer -2.400 1.4e-06
pancreatic cancer -1.200 4.7e-04
breast carcinoma -2.900 1.1e-43
Breast cancer -4.700 2.2e-02
lung adenocarcinoma -3.100 1.7e-25
atypical teratoid/rhabdoid tumor -1.300 3.9e-02
invasive ductal carcinoma -3.600 3.2e-04
lung carcinoma -1.400 5.1e-08
Pick disease 2.000 1.3e-05
progressive supranuclear palsy -1.200 1.6e-02
gastric carcinoma -2.500 3.1e-02
ductal carcinoma in situ -2.600 1.0e-04
ovarian cancer -2.400 7.6e-05
pituitary cancer -1.200 1.1e-02

Protein-protein Interaction (4)

Gene RIF (38)

PMID Text
26329521 High LIFr expression stimulates melanoma cell migration and is associated with unfavorable prognosis in melanoma.
26285796 The C65S mutant LIFR showed altered glycosylation and an elevated expression level that might be attributed to a slow turnover of the mutant form.
26249360 these findings conclude that LIFR functions as a novel metastasis suppressor in Hepatocellular carcinoma and may serve as a prognostic biomarker for Hepatocellular carcinoma patients.
25790555 Studied the association of tubal pregnancy with leukemia inhibitory factor (LIF) and leukemia inhibitory factor receptor (LIFR) expression in oviduct tissues.
25749520 LIFR may play a functional role in hepatocarcinogenesis
25514345 Expression of the LIF receptor was strongly increased on immune cells of multiple sclerosis patients.
25145448 Stuve-Wiedemann syndrome patients with (p.Arg692X) LIFR mutation may develop central adrenal insufficiency due to impaired LIF/LIFR signalling. LIF/LIFR system plays a role in human HPA axis regulation.
25092123 The LIFRalpha-CT3 TAT fusion protein can inhibit miR-155 expression
24802752 R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR.
24618404 LIFR signaling usually follows the JAK/STAT3 pathway, and is initiated by several interleukin-6-type cytokines
24074901 Data suggest LIF/LIF receptor (alpha subunit) signal transduction facilitates blastocyst implantation or development of tubal pregnancy by stimulating blastocyst adhesion and outgrowth/proliferation of placenta or Fallopian tube epithelial cells.
23579219 LIFR rs3729740 and possibly ANXA11 rs1049550 may be useful as biomarkers for predicting whether metastatic colorectal cancer patients are sensitive to relevant target regimens, although further validation in large cohorts is needed.
23382563 Because acute ventricle enlargement is observed in susceptible CD118-deficient mice, the phenomenon may occur in a subpopulation of human adults with herpes simplex encephalitis.
23001183 findings identify LIFR as a metastasis suppressor that functions through the Hippo-YAP pathway and has significant prognostic power.
22829597 A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor.
22535017 findings show that LIFR is a key novel tumor suppressor, whose deregulation may drive the transformation of a significant proportion of human breast cancers
21971603 A significant association was detected between the LIFR gene polymorphisms and schizophrenia patients with persecutory delusion
21966484 LIF and LIFR immunolocalized to decidual cells in the mid-late secretory phase endometrium and 1st trimester decidua.
21617854 These results demonstrate that cancer-specific methylation and a specific decrease of LIFR expression are a common inactivation event in colon cancer development.
20654748 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19879916 The present study indicated that the LIF gene variant may produce susceptibility to hebephrenic schizophrenia and deterioration of working memory function.
19733004 Down regulation of Leukemia inhibitory factor receptor is associated with hepatocellular carcinoma.
19453261 Observational study of gene-disease association. (HuGE Navigator)
18775332 Results present the biophysical and structural characterization of the full-length, transmembrane form of a quaternary cytokine receptor complex consisting of gp130, LIF-R, Ciliary Neurotrophic Factor (CNTF), and its alpha receptor (CNTF-Ralpha).
17332938 The regulation of LIF and its receptor (LIFR) expression in pancreatic carcinoma cells were studied.
17028186 sOSMR is able to bind OSM and interleukin-31 when associated to soluble gp130 or soluble interleukin-31R, respectively, and to neutralize both cytokine properties
16949591 Expression of leukemia inhibitory factor and its receptor is low in undifferentiated human embryonic stem cells but increases during differentiation.
16759928 Down-regulation of PRB in the endometrium is concomitant with the presence of glycodelin in the endometrium, suggesting interaction.
16051226 In cells overexpressing a LIFR mutant with the N-terminal cytokine binding domain deleted, signaling by ciliary neurotrophic factor was abolished.
15180980 At early human post-implantation stage, LIF is produced from decidua and chorionic villi and may exert its action on trophoblasts. Anembryonic pregnancy cannot be accounted for by defective expression of either LIF or LIF-Rbeta in most circumstances.
15044601 immunocytochemical staining and mRNA expression of LIF and its receptor are consistent with the concept that LIF might be involved in growth initiation of human primordial follicles through its receptor
14740318 mutations alter the stability of LIFR messenger RNA transcripts, resulting in the absence of the LIFR protein and in the impairment of the JAK/STAT3 signaling pathway in patient cells
12707269 Leukemia inhibitory factor (LIF), cardiotrophin-1, and oncostatin M share structural binding determinants in the immunoglobulin-like domain of LIF receptor
12707266 interactions of CNTFR with LIFR and gp130 in vitro
11834739 Separate functions for the two modules of the membrane-proximal cytokine binding domain of glycoprotein 190, the leukemia inhibitory factor low affinity receptor, in ligand binding and receptor activation (gp190)
11812136 upper cytokine-binding module and the Ig-like domain of the leukaemia inhibitory factor (LIF) receptor are sufficient for a functional LIF receptor complex
11042511 Review. The structure and function of the LIF-R gene and protein, mRNA processing, and its role in tumor cells are reviewed.

AA Sequence

MMDIYVCLKRPSWMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPHDLKCVTNNLQVWNCSWKAP      1 - 70
SGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSKFTLNEQNVSLIPDTPE     71 - 140
ILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKESMELVKLVTHNTTLNGKDTLHHWSWASDMP    141 - 210
LECAIHFVEIRCYIDNLHFSGLEEWSDWSPVKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSA    211 - 280
LIGHTNCPLIHLDGENVAIKIRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEII    281 - 350
CSWNPGRVTALVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQLLFQMLPNQEIYNFTLNAHNPLGRSQ    351 - 420
STILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCEIEIKKSNSVQEQRNVTIKGVENS    421 - 490
SYLVALDKLNPYTLYTFRIRCSTETFWKWSKWSNKKQHLTTEASPSKGPDTWREWSSDGKNLIIYWKPLP    491 - 560
INEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIRLDKNDYIISVVAKNSVGSSPPSKIASMEIPNDD    561 - 630
LKIEQVVGMGKGILLTWHYDPNMTCDYVIKWCNSSRSEPCLMDWRKVPSNSTETVIESDEFRPGIRYNFF    631 - 700
LYGCRNQGYQLLRSMIGYIEELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDT    701 - 770
SKMRVLESGRSDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENSVGLIIAI    771 - 840
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEMNPCTPNNVEV    841 - 910
LETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPNPAADEAGGTAQVIYIDVQSM    911 - 980
YQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDIAAEEDLDKTAGYRPQANVNTWNLVSPDSPRSIDS    981 - 1050
NSEIVSFGSPCSINSRQFLIPPKDEDSPKSNGGGWSFTNFFQNKPND                          1051 - 1097
//

Text Mined References (71)

PMID Year Title
26329521 2015 High LIFr expression stimulates melanoma cell migration and is associated with unfavorable prognosis in melanoma.
26285796 2016 Non-truncating LIFR mutation: causal for prominent congenital pain insensitivity phenotype with progressive vertebral destruction?
26249360 2015 LIFR functions as a metastasis suppressor in hepatocellular carcinoma by negatively regulating phosphoinositide 3-kinase/AKT pathway.
25790555 2015 Aberrant expression of leukemia inhibitory factor receptor (LIFR) and leukemia inhibitory factor (LIF) is associated with tubal pregnancy occurrence.
25749520 2015 Leukemia inhibitory factor receptor is a novel immunomarker in distinction of well-differentiated HCC from dysplastic nodules.
25514345 2015 Leukemia inhibitory factor tips the immune balance towards regulatory T cells in multiple sclerosis.
25145448 2015 Effects of leukemia inhibitory receptor gene mutations on human hypothalamo-pituitary-adrenal function.
25092123 2014 LIFR?-CT3 induces differentiation of a human acute myelogenous leukemia cell line HL-60 by suppressing miR-155 expression through the JAK/STAT pathway.
24802752 2014 The amino acid exchange R28E in ciliary neurotrophic factor (CNTF) abrogates interleukin-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130 (gp130)/leukemia inhibitory factor receptor (LIFR).
24618404 2014 Stüve-Wiedemann syndrome: LIFR and associated cytokines in clinical course and etiology.
24074901 2013 The role of leukemia inhibitory factor in tubal ectopic pregnancy.
23579219 2013 Feasibility of proposed single-nucleotide polymorphisms as predictive markers for targeted regimens in metastatic colorectal cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382563 2013 Microglia and a functional type I IFN pathway are required to counter HSV-1-driven brain lateral ventricle enlargement and encephalitis.
23001183 2012 LIFR is a breast cancer metastasis suppressor upstream of the Hippo-YAP pathway and a prognostic marker.
22829597 2012 A unique loop structure in oncostatin M determines binding affinity toward oncostatin M receptor and leukemia inhibitory factor receptor.
22535017 2012 Whole genome in vivo RNAi screening identifies the leukemia inhibitory factor receptor as a novel breast tumor suppressor.
21971603 2012 Association between promoter polymorphisms of the LIFR gene and schizophrenia with persecutory delusion in a Korean population.
21966484 2011 Leukemia inhibitory factor enhances endometrial stromal cell decidualization in humans and mice.
21617854 2011 Promoter methylation of leukemia inhibitory factor receptor gene in colorectal carcinoma.
20654748 2010 High-density polymorphisms analysis of 23 candidate genes for association with bone mineral density.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19879916 2010 Leukemia inhibitory factor gene is associated with schizophrenia and working memory function.
19733004 2010 Leukemia inhibitory factor receptor (LIFR) is detected as a novel suppressor gene of hepatocellular carcinoma using double-combination array.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18775332 2008 Structural organization of a full-length gp130/LIF-R cytokine receptor transmembrane complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17436251 2007 Mutations in cytokine receptor-like factor 1 (CRLF1) account for both Crisponi and cold-induced sweating syndromes.
17332938 2007 Leukemia inhibitory factor functions as a growth factor in pancreas carcinoma cells: Involvement of regulation of LIF and its receptor expression.
17028186 2006 Molecular and functional characterization of a soluble form of oncostatin M/interleukin-31 shared receptor.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16949591 2006 Expression of leukemia inhibitory factor and its receptors is increased during differentiation of human embryonic stem cells.
16759928 2006 Glycodelin is present in pinopodes of receptive-phase human endometrium and is associated with down-regulation of progesterone receptor B.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16051226 2005 The N-terminal cytokine binding domain of LIFR is required for CNTF binding and signaling.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15184896 2004 Interleukin 31, a cytokine produced by activated T cells, induces dermatitis in mice.
15180980 2004 Expression of leukemia inhibitory factor and its receptor is not altered in the decidua and chorionic villi of human anembryonic pregnancy.
15044601 2004 Immunocytochemical detection and RT-PCR expression of leukaemia inhibitory factor and its receptor in human fetal and adult ovaries.
14740318 2004 Null leukemia inhibitory factor receptor (LIFR) mutations in Stuve-Wiedemann/Schwartz-Jampel type 2 syndrome.
14504285 2003 GPL, a novel cytokine receptor related to GP130 and leukemia inhibitory factor receptor.
12707269 2003 Leukemia inhibitory factor (LIF), cardiotrophin-1, and oncostatin M share structural binding determinants in the immunoglobulin-like domain of LIF receptor.
12707266 2003 Solution structure of the C-terminal domain of the ciliary neurotrophic factor (CNTF) receptor and ligand free associations among components of the CNTF receptor complex.
12643274 2003 Signaling of human ciliary neurotrophic factor (CNTF) revisited. The interleukin-6 receptor can serve as an alpha-receptor for CTNF.
12601009 2003 Mutations in the immunoglobulin-like domain of gp190, the leukemia inhibitory factor (LIF) receptor, increase or decrease its affinity for LIF.
12574225 2003 Leukemia inhibitory factor regulates prolactin secretion in prolactinoma and lactotroph cells.
12047380 2002 A functional role of the membrane-proximal extracellular domains of the signal transducer gp130 in heterodimerization with the leukemia inhibitory factor receptor.
11943154 2002 Membrane distal cytokine binding domain of LIFR interacts with soluble CNTFR in vitro.
11834739 2002 Separate functions for the two modules of the membrane-proximal cytokine binding domain of glycoprotein 190, the leukemia inhibitory factor low affinity receptor, in ligand binding and receptor activation.
11834704 2002 Cardiotrophin-1 stimulation of cardiac fibroblast growth: roles for glycoprotein 130/leukemia inhibitory factor receptor and the endothelin type A receptor.
11730732 2001 Leukemia inhibitory factor in human reproduction.
11285233 2001 The ciliary neurotrophic factor receptor alpha component induces the secretion of and is required for functional responses to cardiotrophin-like cytokine.
11042511 2000 Structural and functional studies on the leukemia inhibitory factor receptor (LIF-R): gene and soluble form of LIF-R, and cytoplasmic domain of LIF-R required for differentiation and growth arrest of myeloid leukemic cells.
10858440 2000 Stimulation of leukemia inhibitory factor receptor degradation by extracellular signal-regulated kinase.
10854707 2000 Expression of leukemia inhibitory factor (LIF) and LIF receptor (LIF-R) in the human adrenal cortex: implications for steroidogenesis.
10800945 2000 Differential regulation of leukemia inhibitory factor-stimulated neuronal gene expression by protein phosphatases SHP-1 and SHP-2 through mitogen-activated protein kinase-dependent and -independent pathways.
10101017 1999 Leukemia inhibitory factor (LIF) and LIF receptor in human lung. Distribution and regulation of LIF release.
9920829 1999 Reconstitution of the functional mouse oncostatin M (OSM) receptor: molecular cloning of the mouse OSM receptor beta subunit.
9525740 1998 The recurrent translocation t(5;8)(p13;q12) in pleomorphic adenomas results in upregulation of PLAG1 gene expression under control of the LIFR promoter.
9346946 1997 Identification of an upstream enhancer within a functional promoter of the human leukemia inhibitory factor receptor gene and its alternative promoter usage.
8999038 1996 Dual oncostatin M (OSM) receptors. Cloning and characterization of an alternative signaling subunit conferring OSM-specific receptor activation.
8864865 1996 Structure of the gene encoding the human differentiation-stimulating factor/leukemia inhibitory factor receptor.
8583009 1995 Expression of leukaemia inhibitory factor (LIF) receptor in human placenta: a possible role for LIF in the growth and differentiation of trophoblasts.
8547494 1995 Stage-specific expression of cytokine and receptor messenger ribonucleic acids in human preimplantation embryos.
8276403 1993 The leukemia inhibitory factor receptor (LIFR) gene is located within a cluster of cytokine receptor loci on mouse chromosome 15 and human chromosome 5p12-p13.
7957045 1994 Cloning of a murine IL-11 receptor alpha-chain; requirement for gp130 for high affinity binding and signal transduction.
7777512 1995 Phosphorylation of the human leukemia inhibitory factor (LIF) receptor by mitogen-activated protein kinase and the regulation of LIF receptor function by heterologous receptor activation.
7512571 1994 Ciliary neurotrophic factor/leukemia inhibitory factor/interleukin 6/oncostatin M family of cytokines induces tyrosine phosphorylation of a common set of proteins overlapping those induced by other cytokines and growth factors.
1915266 1991 Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130.
1542794 1992 The IL-6 signal transducer, gp130: an oncostatin M receptor and affinity converter for the LIF receptor.
1536831 1992 Oncostatin M binds the high-affinity leukemia inhibitory factor receptor.