Property Summary

NCBI Gene PubMed Count 173
PubMed Score 521.79
PubTator Score 2397.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -1.400 1.4e-05
ependymoma 1.400 9.0e-05
glioblastoma 1.900 2.7e-03
atypical teratoid / rhabdoid tumor 1.300 3.6e-03
primary pancreatic ductal adenocarcinoma 1.679 1.4e-02
intraductal papillary-mucinous neoplasm ... 2.100 7.9e-04
lung cancer -2.800 3.2e-04
pancreatic cancer 1.600 3.2e-03
interstitial cystitis 1.100 8.7e-04
pediatric high grade glioma 1.700 2.7e-04
pilocytic astrocytoma 2.000 1.5e-09
subependymal giant cell astrocytoma 1.482 3.1e-02
inflammatory breast cancer -1.200 2.2e-03
pituitary cancer -1.100 7.3e-03
chronic rhinosinusitis -1.010 3.3e-02
psoriasis -1.600 8.7e-65

Gene RIF (150)

PMID Text
26817565 This review discusses the role of LIF and the recent analysis of its action on the uterine LE in regulating endometrial receptivity and implantation.
26776907 Women with dormant genital tuberculosis were found to have decreased endometrial LIF-STAT3 signaling.
26723254 Taken together, we firstly demonstrate that LIF enhances the adhesion of trophoblastic cells to endometrial cells by up-regulating expression of integrin heterodimer alphaVbeta3 and alphaVbeta5.
26716902 Overexpression of LIF promotes Epithelial-mesenchymal transition and results in cancer.
26296968 Data show that leukemia inhibitory factor (LIF) signaling promote chemoresistance in cholangiocarcinoma by up-regulating myeloid cell factor-1 (Mcl-1) via phosphatidylinositol 3-kinase (PI3K)/c-akt protein (AKT)-dependent pathway.
26271643 LIF was frequently overexpressed in osteosarcoma, which could promote the growth and invasion through activating the STAT3 pathway.
26187859 Despite common signal transduction mechanisms (JAK/STAT, MAPK and PI3K) LIF can have paradoxically opposite effects in different cell types including stimulating or inhibiting each of cell proliferation, differentiation and survival.
25885043 LIF/p21 signaling cascade as a novel tumor suppressive-like pathway in melanoma, acting downstream of TGFbeta to regulate cell cycle arrest and cell death, further highlight new potential therapeutic strategies for the treatment of cutaneous melanoma
25879318 LIF structure, signaling pathway, and primary roles in the development and function of an organism are reviewed--{REVIEW}
25790555 Studied the association of tubal pregnancy with leukemia inhibitory factor (LIF) and leukemia inhibitory factor receptor (LIFR) expression in oviduct tissues.
25514345 LIF downregulates the autoimmune response by enhancing Treg numbers.
25323535 LIF has a role in negatively regulating tumour-suppressor p53 through Stat3/ID1/MDM2 in colorectal cancers
25277705 Expression of LIF protects the lung from lung injury and enhanced pathology during respiratory syncytial virus infection.
25179300 Data indicate that NanoLuc-fusion strategy provided an efficient approach for preparation of recombinant leukemia inhibitory factor (LIF) protein
25128195 An increased mRNA expression of PROK1 and LIF could be one of the several abnormalities characterizing the endometrium in women recurrent pregnancy loss.
24857661 LIF mediates fibroblast activation to promote invasive tumor microenvironment.
24743237 an essential function of Foxm1 in the LIF/Stat3-mediated mESC self-renewal and the generation of iPSCs
24690239 The use of LIF in combination with alphanubeta3 integrin as biomarkers appears to be superior to integrin testing alone when evaluating endometrial receptivity, primarily because of its earlier pattern of expression during the secretory phase.
24664722 This mini review will summarize the findings that are related to LIF signaling and discuss the neuroprotective effects of LIF in different models.
24310780 Addition of leukemia inhibitory factor (LIF) neutralizing antibodies inhibited oligodendrocyte differentiation, indicating a crucial role of TNFR2-induced astrocyte derived LIF for oligodendrocyte maturation
24270418 NPC patients had increased serum levels of LIF. Higher LIF levels correlated with local tumor recurrence. Xenograft mouse studies showed that LIF critically contributes to NPC tumor growth & radioresistance.
24074901 Data suggest LIF/LIF receptor (alpha subunit) signal transduction facilitates blastocyst implantation or development of tubal pregnancy by stimulating blastocyst adhesion and outgrowth/proliferation of placenta or Fallopian tube epithelial cells.
23963683 Results show that endogenous levels of Pkig reciprocally regulate osteoblast and adipocyte differentiation and that this reciprocal regulation is mediated in part by LIF.
23876532 Polyethylene glycated leukemia inhibitory factor antagonist inhibits human blastocyst implantation and triggers apoptosis by down-regulating embryonic AKT1.
23867815 Human LIF protein upregulates HIV-1 p24 production in the chronically infected promonocytes in a dose-dependent manner
23831429 In summary, we can show that LIF is an important factor in melanoma progression.
23729555 Data from 3-year-old girl and other reported cases support model in which abundance of LIF in B-cell acute lymphoblastic leukemia results in leukemic infiltration of central nervous system and development of Cushing syndrome. [CASE STUDY; REVIEW]
23687977 Data show that the expressions of ER-alpha, PR, LIF, VEGF, iNOS and CB1 in fallopian tube and chorionic villi of tubal pregnancy were not altered by exposure to levonorgestrel emergency contraception.
23628981 novel expression and purification protocol for the production of recombinant hLIF
23541977 study found lower expression of LIF in the edndometrium in unexplained infertile women with multiple implantation failures compared to fertile women; data suggest that the initial lower expression of LIF in proliferative phase may be one of the causes for multiple failure of implantation
23122949 Identification of novel molecules associated with a LIF-mediated increase in trophoblastic cell invasion may facilitate our understanding of implantation biology.
22905257 Acyloxy nitroso compounds inhibit LIF signaling in endothelial cells and cardiac myocytes, showing that STAT3 signaling is redox-sensitive
22835519 LIF combined with VEGF can maintain the preliminary, progenitor phenotype of EPCs and alleviate cell differentiation by upregulating KLF4, which may provide new insights into transcriptional regulation in endothelial progenitor cells
22720020 findings suggest that our LIF-dependent human iPSCs could provide a novel model to investigate the role of cytokine signaling in cellular reprogramming
22712053 Data show that LIF through STAT3 negatively regulates Th2 differentiation.
22698642 Expression of LIF and integrin-beta3 (ITGB3) in the peri-implantation endometrium does not change in women with unexplained recurrent pregnancy loss.
22649064 Although leukemia inhibitory factor (LIF) and LIF receptors were increased in muscle tissue and myoblasts from diabetic patients, LIF signaling and LIF-induced cell proliferation were impaired in diabetic myoblasts.
22537815 there is an altered expression of LIF and IL-15 in the endometrium of women with recurrent implantation failure
22520363 LIF was expressed in endometrium of fertile women but significantly decreased in infertile women. Infertile women secreted significantly less LIF molecules in uterine flushing compared with fertile women.
22436290 plasma concentrations is a predictive marker of in vitro fertilization outcome
22341639 LIF mRNA expression was significantly decreased in abnormal uterine cavities during the midsecretory phase, indicating that endometrial cavity defects are a possible cause of poor reproductive outcomes.
22323722 LIF delivery can be harnessed to enhance the generation of oligodendrocytes that express myelin proteins and reform the nodes of Ranvier in the context of chronic demyelination in the adult mouse hippocampus.
22285730 LIF expression might be regulated by microRNA-199a
22252755 No correlation was found between pinopodes development stage and LIF expressions in endometrium.
22142941 Addition of IL-4 or IL-13 had no effect on IL-6 expression, but significantly inhibited LIF and IL-11 mRNA and protein stimulated by IL-1beta and TNF-alpha.
21987111 Endometrial HOXA11 and LIF mRNA expression levels (normalized to beta-actin expression) were significantly decreased in endometrium of infertile patients with endometriosis compared with healthy fertile controls
21966484 Study demonstrated that LIF was an important regulator of decidualization in humans and mice.
21745467 stimulation with alpha(1)-adrenoceptor may enhance DNA synthesis and proliferation of mouse iPS cells cultured with LIF via augmentation of both the MEK/MAPK and the PI3K/Akt pathways
21726338 MiR-141 has been significantly downregulated by more than 50% after leukemia inhibitory factor stimulation
21613225 Extensive mannose phosphorylation on leukemia inhibitory factor (LIF) controls its extracellular levels by multiple mechanisms.
21570299 LIF could be significantly involved in the pathophysiology of Multiple sclerosis
21527666 LIF is a contraction-induced myokine, potentially acting in an autocrine or paracrine fashion to promote skeletal muscle satellite cell proliferation.
21191816 The epigenetic up-regulation of the LIF gene likely play an important role in the development of breast cancer.
21178106 The cytokine LIF promotes trafficking of T-type calcium channel subunits in human HEK293 cells via transient activation of JAK- and ERK-kinase signaling pathways.
21155043 Serum concentrations of IL-6 family cytokines, including IL-6, IL-11, and LIF, were significantly elevated in patients with RA compared to those of healthy controls.
21129244 TGFbeta1, TNFalpha and LIF expressions showed increased level in the untreated patients with de novo acute myeloid leukemia.
20851233 OPN, IL-6 and LIF may have critical roles in human pregnancy maintenance.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20618183 Patients with recurrent spontaneous abortion not only displayed a decrease in LIF expression but also had a reduced frequency of endometrial infiltrated CD4+ LIF+ cells in comparison with fertile women.
20597819 Wharton's jelly - and adipose tissue-mesenchymal stromal cells (MSCc) were more potent than BMbone marrow-MSCs in suppressing lymphocyte responses, and they mediated this effect by secreting high levels of leukemia inhibitory factor.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20570039 Suggest that growth inhibition and activation of the autocrine/paracrine signaling through LIF/JAK/STAT may be a common response to Ras/Raf activation in different medullary thyroid carcinoma types.
20396801 Results describe the effects of 6-h marathon ultra-race on the levels of IL-6, leukemia inhibiting factor (LIF), and stem cell growth factor (SCF) in athletes.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20074285 LIF protein is expressed in Alzheimer's and Parkinson diseases.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19879916 Observational study of gene-disease association. (HuGE Navigator)
19751193 Studies indicate that leptin, CNTF, LIF and IL-6 present similar three-dimensional fold structure, interact with related class-I receptors and activate similar intracellular pathways.
19704963 The expression of mRNA isoforms for leukemia-inhibitory factor changes with embryonic and neonatal development, changes reflect a decrease in stimulatory influences on the expression and number of LIF-producing circulating cells
19647472 Studies indicate potential of LIF/IL11 as contraceptive targets and therapeutic agents for infertility.
19550366 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19548631 The levels of E-selectin, ICAM-1, IL-11, IRF-1, IL-6, IL-1beta and LIF genes expression in the B. pseudomallei-infected cells were 1.5-5 times lower than in the B. thailandensis-infected cells.
19545488 The results suggest that in LIF gene mutation-positive women the idiopathic infertility and endometriosis have a negative impact on the outcome of IVF treatment.
19545488 Observational study of gene-disease association. (HuGE Navigator)
19541590 The key features of leukaemia inhibitory factor cytokine, its numerous physiological effects the most recent data are presented. Review.
19495417 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b
19470478 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19374770 LIF has a role in the optimization of the endometrium for embryo implantation.
19361790 Leukemia inhibitory factor is dysregulated in the endometrium and uterine flushing fluid of women with adenomyosis during the implantation window.
19342253 Results indicate that leukemia inhibitory factor (LIF) and Oncostatin M increase the expression of MMP-1, MMP-3, and TIMP-1 several fold, and that their expression is reduced to basal levels in the presence of the LIF antagonist MH35-BD.
19255255 hCG-mediated LIF expression in the endometrium is dependent on prior induction of PROK1.
19251277 results indicate that LIF 3' UTR StuI polymorphism is not associated with multiple sclerosis, however we cannot exclude the hypothesis that other polymorphic alleles of LIF could be implicated in MS susceptibility
19251277 Observational study of gene-disease association. (HuGE Navigator)
19213836 IL-11 and LIF regulated endometrial epithelial cell adhesion, suggesting that targeting IL-11 and LIF may be useful in regulating fertility by either enhancing or blocking implantation.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19011087 In silico models predicted that five of the up-regulated miRNAs targeted leukemia inhibitory factor (LIF) expression
18953658 A potential role for LIF in the melanoma-induced bone metastasis possibly through the stimulation of osteoclastogenesis is suggested.
18684446 Unexplained infertility in some women might be explained by disturbances in the LIF pathway in midsecretory-phase endometrium.
18639869 Results describe the role of leukemia inhibitory factor in human mesenchymal stem cell-mediated immunosuppression.
18637760 LIF secretion is a predictor and indicator of early progenitor status in adult bone marrow stromal cells.
18540977 Overexpression may be a potential molecular marker for predicting poor prognosis in patients with epithelial ovarian carcinoma.
18492704 LIF can regulate extravillous trophoblast invasion, suggesting an important role in early placental development.
18468598 Leukemia inhibitory factor may be one of the reasons that cause patients with salpingitis to be more susceptible to tubal pregnancy and might be involved in the implantation process of tubal pregnancy.
18317962 secretion of OSM and LIF by both epithelial and stromal (paracrine manner) cells seems to promote tumor growth in human breast carcinoma
18298054 The antiphospolipid antibodies (aPLs) are elevated in infertile women with LIF gene mutations.
18298054 Observational study of gene-disease association. (HuGE Navigator)
18258286 Immunohistochemical labeling of LIF in the fallopian tube was found to be increased in ectopic pregnancies compared to non-pregnant and healthy pregnant controls
18048043 higher levels found in the placentas of pre-eclamptic compared with normotensive women
18047677 Present predominantly in glandular epithelium.
18042242 Increased LIF expression in peri-infarcted regions and sequestration from the peripheral circulation in acute stroke patients are characteristic of the pathobiological response to ischaemia and tissue damage.
17979974 Increased expression of some IL-6 cytokine family members (oncostatin M, gp130, CT-1, LIF) in cutaneous inflammation might contribute to the promotion of hair loss.
17966612 Observational study of gene-disease association. (HuGE Navigator)
17966612 the LIF gene mutation, the heterozygote G to A transition on the position 3400, affects fertility but the infertility treatment can succeed.
17848619 LIF and IL6 skew monocyte differentiation into tumor-associated macrophage (TAM)-like cells by enabling monocytes to consume monocyte-CSF. Depletion of LIF, IL-6, and M-CSF in ovarian cancer ascites suppressed TAM-like cell induction
17702963 Observational study of gene-disease association. (HuGE Navigator)
17681328 Endometrial integrin beta3 and LIF expressions in the peri-implantation phase were significantly lower in stimulated cycles (including both moderate and high responders) compared to natural controls.
17671691 interleukin-8 (CXCL-8) is induced by tumor necrosis factor-alpha and leukemia inhibitory factor in pancreatic carcinoma cells
17652170 provides a structural template to understand the formation and orientation of the high-affinity signaling complex between LIF, LIF receptor, and gp130
17411373 Human LIF protein upregulates HIV-1 p24 production in the chronically infected promonocytes in a dose-dependent manner
17332938 The regulation of LIF and its receptor (LIFR) expression in pancreatic carcinoma cells were studied.
17054938 Ciliary neurotrophic factor/LIF signaling pathway acts via regulation of nitric oxide production to modulate developmental programmed cell death of postmitotic rod precursor cells.
17000646 There is no receptivity defect with regard to LIF and IL-11 secretions by eutopic endometrium in infertile women with endometriosis.
16949591 Suppressor of cytokine signaling-1 may prevent leukemia inhibitory factor signaling in human embryonic stem cells.
16759928 Down-regulation of PRB in the endometrium is concomitant with the presence of glycodelin in the endometrium, suggesting interaction.
16648972 Since we demonstrated that not only SDF-1, but also HGF and LIF are upregulated in damaged tissues, we postulate that CXCR4+ c-Met+ LIF-R+ TCSC could be mobilized from the BM into the PB, where they play a role in tissue repair/regeneration.
16545901 Observational study of gene-disease association. (HuGE Navigator)
16545901 results suggest that the LIF gene mutations affect fertility
16489116 Data show that increased leukemia inhibitory factor secretion enhances airway reactivity and intracellular calcium signaling.
16341766 Leukemia inhibitory factor concentration in follicular fluid is not a useful marker for the prediction of number and quality of embryos, or implantation and pregnancy rates.
16295654 LIF plays an essential role in the preimplantation embryo development and the blastocyst implantation and its gene mutations in women contribute to the implantation failure and subsequent infertility.
16263181 Observational study of gene-disease association. (HuGE Navigator)
15905624 different members of the TGF-beta superfamily may also contribute in the reproductive process by enhancing endometrial proimplantatory LIF secretion and reducing proinflammatory IL-6 release by endometrial epithelium
15837065 demonstrate using RNAi that Stat3 activation is necessary in the invasive phenotype of trophoblast cells and can be controlled via Leukemia Inhibitory Factor (LIF)
15731310 role of leukemia inhibitory factor (LIF) and its receptors in human embryo implantation
15670782 These results indicated that LIF induced multi-lineage differentiation of adult stem-like cells in kidney via cadherin 16.
15543003 LCH represents a cytokine-driven condition partially mediated by TNF, IL-11, and LIF. These three cytokines are all osteoclastogenic, suggesting a pathogenetic pathway for the osteolytic lesions in LCH.
15342941 LIFRbeta and the signaling subunit gp130 are expressed in hESCs and human LIF can induce STAT3 phosphorylation and nuclear translocation in hESCs.
15341921 Both IL-6 and LIF can be very efficiently induced by IL-1beta in articular chondrocytes in vitro, more so in osteosarthritis than in normal cells.
15180980 At early human post-implantation stage, LIF is produced from decidua and chorionic villi and may exert its action on trophoblasts. Anembryonic pregnancy cannot be accounted for by defective expression of either LIF or LIF-Rbeta in most circumstances.
15044601 immunocytochemical staining and mRNA expression of LIF and its receptor are consistent with the concept that LIF might be involved in growth initiation of primordial follicles through its receptor
14715713 Constitutive expression of cytokines in brain induces changes in gene expression characteristic of chronic inflammation leading to either temporal weight reduction (CNTF) or severe cachexia (leukemia inhibitory factor).
14687743 Decreased concentartion of LIF in infertile women do not seem to have a genetic basis due to the low frequency of LIF gene alterations.
14647442 role in hepatocyte growth factor expression
14557674 binding of ETS transcription factors to the ETS binding sites in the human LIF promoter is critical for its inducibility in response to T cell activators and play an important functional role within the endocrine-immune network.
12807438 Leukemia inhibitory factor (LIF) increased overall expansion of human neural precursor cells grown in culture; Following LIF withdrawal, 200 genes showed significant decreases
12764151 LIF has a role in src family kinase-independent signal transduction and gene induction
12707269 Leukemia inhibitory factor (LIF), cardiotrophin-1, and oncostatin M share structural binding determinants in the immunoglobulin-like domain of LIF receptor
12579339 LIF regulates cell survival of normal human endometrial stromal cells dose-dependently.
12574225 role for LIF in loss of autocrine prolactin suppression contributing to unrestrained prolactinomas prolactin secretion.
12218157 LIF stimulates (45)Ca release and enhances expression of receptor activator of NF-kappa B ligand (RANKL) and osteoprotegerin in neonatal mouse calvarial cultures, but has no effect on the expression of RANK.
12153570 experimental N-Myc overexpression results in down-regulation of leukemia inhibitory factor (LIF), a modulator of endothelial cell proliferation
12089333 Human LIF protein upregulates HIV-1 p24 production in the chronically infected promonocytes in a dose-dependent manner
11855863 LIF does not activate STAT3, ERK, or gp130 receptor in human N tera-2/D1 EC cells. The suppressor of cytokine signaling 1 (SOCS-1) is constitutively expressed, suggesting that LIF signal transduction is inhibited by elevated levels of SOCS-1 expression.
11811789 Oncostatin M and leukemia inhibitory factor regulate the growth of normal human breast epithelial cells
11587067 Observational study of genotype prevalence. (HuGE Navigator)
11587067 The entire structure of the LIF gene of 48 alleles in the Japanese population was sequenced.
11448119 LIF stimulates proliferation of rat pituitary tumor cells in culture, inhibits secretion of prolactin and growth hormone and induces tyrosine phosphorylation of STAT3 in the cells.
8207643 Human LIF protein upregulates HIV-1 p24 production in the chronically infected promonocytes in a dose-dependent manner

AA Sequence

MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQ      1 - 70
GEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNAT     71 - 140
ADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF            141 - 202
//

Text Mined References (174)

PMID Year Title
26817565 2016 The Multifaceted Actions of Leukaemia Inhibitory Factor in Mediating Uterine Receptivity and Embryo Implantation.
26776907 2016 Dysregulated leukemia inhibitory factor and its receptor regulated signal transducers and activators of transcription 3 pathway: a possible cause for repeated implantation failure in women with dormant genital tuberculosis?
26723254 2016 Integrin ?V?3 and ?V?5 are required for leukemia inhibitory factor-mediated the adhesion of trophoblast cells to the endometrial cells.
26716902 2016 Leukemia inhibitory factor promotes EMT through STAT3-dependent miR-21 induction.
26296968 2015 Leukemia inhibitory factor protects cholangiocarcinoma cells from drug-induced apoptosis via a PI3K/AKT-dependent Mcl-1 activation.
26271643 2015 Leukemia inhibitory factor promotes tumor growth and metastasis in human osteosarcoma via activating STAT3.
26187859 2015 Leukemia inhibitory factor (LIF).
25885043 2015 The leukemia inhibitory factor (LIF) and p21 mediate the TGF? tumor suppressive effects in human cutaneous melanoma.
25879318 2015 Role of leukemia inhibitory factor in the nervous system and its pathology.
25790555 2015 Aberrant expression of leukemia inhibitory factor receptor (LIFR) and leukemia inhibitory factor (LIF) is associated with tubal pregnancy occurrence.
25514345 2015 Leukemia inhibitory factor tips the immune balance towards regulatory T cells in multiple sclerosis.
25323535 2014 LIF negatively regulates tumour-suppressor p53 through Stat3/ID1/MDM2 in colorectal cancers.
25277705 2014 Leukemia inhibitory factor protects the lung during respiratory syncytial viral infection.
25179300 2014 Nanoluciferase as a novel quantitative protein fusion tag: Application for overexpression and bioluminescent receptor-binding assays of human leukemia inhibitory factor.
25128195 2014 Prokineticin 1 and leukemia inhibitory factor mRNA expression in the endometrium of women with idiopathic recurrent pregnancy loss.
24857661 2014 LIF mediates proinvasive activation of stromal fibroblasts in cancer.
24743237 2014 Foxm1 mediates LIF/Stat3-dependent self-renewal in mouse embryonic stem cells and is essential for the generation of induced pluripotent stem cells.
24690239 2014 Prospective assessment of midsecretory endometrial leukemia inhibitor factor expression versus ???3 testing in women with unexplained infertility.
24664722 2014 Leukemia inhibitory factor signaling in degenerating retinas.
24310780 2014 Astrocyte-specific activation of TNFR2 promotes oligodendrocyte maturation by secretion of leukemia inhibitory factor.
24270418 2013 Leukemia inhibitory factor promotes nasopharyngeal carcinoma progression and radioresistance.
24074901 2013 The role of leukemia inhibitory factor in tubal ectopic pregnancy.
23963683 2013 Protein kinase inhibitor ? reciprocally regulates osteoblast and adipocyte differentiation by downregulating leukemia inhibitory factor.
23876532 2013 Polyethylene glycated leukemia inhibitory factor antagonist inhibits human blastocyst implantation and triggers apoptosis by down-regulating embryonic AKT.
23831429 2013 Impact of LIF (leukemia inhibitory factor) expression in malignant melanoma.
23729555 2013 Cushing syndrome related to leukemic infiltration of the central nervous system: a case report and a possible role of LIF.
23687977 2013 Expressions of candidate molecules in the human fallopian tube and chorionic villi of tubal pregnancy exposed to levonorgestrel emergency contraception.
23628981 2013 High-level expression and efficient one-step chromatographic purification of a soluble human leukemia inhibitory factor (LIF) in Escherichia coli.
23541977 2013 The low expression of leukemia inhibitory factor in endometrium: possible relevant to unexplained infertility with multiple implantation failures.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23122949 2013 Leukemia inhibitory factor increases the invasiveness of trophoblastic cells through integrated increase in the expression of adhesion molecules and pappalysin 1 with a concomitant decrease in the expression of tissue inhibitor of matrix metalloproteinases.
22905257 2012 Acyloxy nitroso compounds inhibit LIF signaling in endothelial cells and cardiac myocytes: evidence that STAT3 signaling is redox-sensitive.
22835519 2012 LIF maintains progenitor phenotype of endothelial progenitor cells via Krüppel-like factor 4.
22783022 2012 The Sin3a repressor complex is a master regulator of STAT transcriptional activity.
22720020 2012 Establishment of LIF-dependent human iPS cells closely related to basic FGF-dependent authentic iPS cells.
22712053 2012 Gene set enrichment analysis identifies LIF as a negative regulator of human Th2 cell differentiation.
22698642 2012 Pinopodes, leukemia inhibitory factor, integrin-?3, and mucin-1 expression in the peri-implantation endometrium of women with unexplained recurrent pregnancy loss.
22649064 2012 Deficient leukemia inhibitory factor signaling in muscle precursor cells from patients with type 2 diabetes.
22537815 2012 Expression of leukaemia inhibitory factor and interleukin 15 in endometrium of women with recurrent implantation failure after IVF; correlation with the number of endometrial natural killer cells.
22520363 2012 Assessment of leukemia inhibitory factor and glycoprotein 130 expression in endometrium and uterine flushing: a possible diagnostic tool for impaired fertility.
22436290 2012 LIF and sIL-2R plasma concentrations in IVF patients on the day of embryo transfer: predictive markers of IVF outcome.
22341639 2012 Expression of leukemia inhibitory factor in the endometrium in abnormal uterine cavities during the implantation window.
22323722 2012 Exogenous leukemia inhibitory factor stimulates oligodendrocyte progenitor cell proliferation and enhances hippocampal remyelination.
22285730 2012 Low microRNA-199a expression in human amniotic epithelial cell feeder layers maintains human-induced pluripotent stem cell pluripotency via increased leukemia inhibitory factor expression.
22252755 2011 No correlation between pinopode formation and LIF and MMP2 expression in endometrium during implantation window.
22142941 2012 Interleukin-4 and interleukin-13 inhibit the expression of leukemia inhibitory factor and interleukin-11 in fibroblasts.
21987111 2011 Semi-quantitative analysis of HOXA11, leukemia inhibitory factor and basic transcriptional element binding protein 1 mRNA expression in the mid-secretory endometrium of patients with endometriosis.
21966484 2011 Leukemia inhibitory factor enhances endometrial stromal cell decidualization in humans and mice.
21745467 2011 ??-Adrenoceptor stimulation enhances leukemia inhibitory factor-induced proliferation of mouse-induced pluripotent stem cells.
21726338 2011 Reduction in miR-141 is induced by leukemia inhibitory factor and inhibits proliferation in choriocarcinoma cell line JEG-3.
21613225 2011 Extensive mannose phosphorylation on leukemia inhibitory factor (LIF) controls its extracellular levels by multiple mechanisms.
21570299 2011 Expression of leukemia inhibitory factor in the cerebrospinal fluid of patients with multiple sclerosis.
21527666 2011 LIF is a contraction-induced myokine stimulating human myocyte proliferation.
21399633 2011 Genome-wide association study identifies susceptibility loci for IgA nephropathy.
21191816 2011 Epigenetic up-regulation of leukemia inhibitory factor (LIF) gene during the progression to breast cancer.
21178106 2011 Leukemia inhibitory factor regulates trafficking of T-type Ca2+ channels.
21155043 2011 The correlation between increased serum concentrations of interleukin-6 family cytokines and disease activity in rheumatoid arthritis patients.
21129244 2010 [Abnormal expression of hematopoietic regulatory factors in newly diagnosed patients with acute myeloid leukemia].
20851233 2010 The effects of mifepristone on the expressions of osteopontin, interleukin-6 and leukemia inhibitory factor in the villi of early pregnant women.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624457 2010 STAT1 activation regulates proliferation and differentiation of renal progenitors.
20618183 2011 Modulation of maternal LIF producers T cells by trophoblast and paternal antigens.
20597819 2010 Adipose-tissue-derived and Wharton's jelly-derived mesenchymal stromal cells suppress lymphocyte responses by secreting leukemia inhibitory factor.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20570039 2010 Leukemia inhibitory factor can mediate Ras/Raf/MEK/ERK-induced growth inhibitory signaling in medullary thyroid cancer cells.
20396801 2009 Effect of a six-hour marathon ultra-race on the levels of IL-6, LIF, and SCF.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20074285 2010 Expression of LIF and LIF receptor beta in Alzheimer's and Parkinson's diseases.
19915574 2009 Common variants at five new loci associated with early-onset inflammatory bowel disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19879916 2010 Leukemia inhibitory factor gene is associated with schizophrenia and working memory function.
19751193 2009 Leptin, ciliary neurotrophic factor, leukemia inhibitory factor and interleukin-6: class-I cytokines involved in the neuroendocrine regulation of the reproductive function.
19704963 2009 Ontogenetic features of the expression of mRNA isoforms for leukemia-inhibitory factor in human fetal tissues and mononuclear cells.
19647472 2009 Leukemia inhibitory factor and interleukin-11: critical regulators in the establishment of pregnancy.
19550366 2009 Multilocus genotypic association with vascular dementia by multifactor dimensionality reduction and entropy-based estimation.
19548631 2009 Differential gene expression profiles of lung epithelial cells exposed to Burkholderia pseudomallei and Burkholderia thailandensis during the initial phase of infection.
19545488 2009 Leukaemia inhibitory factor (LIF) gene mutations in women diagnosed with unexplained infertility and endometriosis have a negative impact on the IVF outcome. A pilot study.
19541590 2009 The LIF cytokine: towards adulthood.
19495417 2009 N-Myc regulates expression of pluripotency genes in neuroblastoma including lif, klf2, klf4, and lin28b.
19470478 2009 Single-nucleotide polymorphisms in the p53 pathway regulate fertility in humans.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19374770 2009 Endometrial claudin-4 and leukemia inhibitory factor are associated with assisted reproduction outcome.
19361790 2010 Leukemia inhibitory factor is dysregulated in the endometrium and uterine flushing fluid of patients with adenomyosis during implantation window.
19342253 2009 Role of a LIF antagonist in LIF and OSM induced MMP-1, MMP-3, and TIMP-1 expression by primary articular chondrocytes.
19255255 2009 Prokineticin 1 mediates fetal-maternal dialogue regulating endometrial leukemia inhibitory factor.
19251277 2009 Study of leukemia inhibitory factor polymorphism within an Australian multiple sclerosis population.
19213836 2009 Interleukin-11 and leukemia inhibitory factor regulate the adhesion of endometrial epithelial cells: implications in fertility regulation.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19011087 2008 Human multipotent stromal cells from bone marrow and microRNA: regulation of differentiation and leukemia inhibitory factor expression.
18953658 2009 A role for leukemia inhibitory factor in melanoma-induced bone metastasis.
18684446 2009 Disturbances in the LIF pathway in the endometrium among women with unexplained infertility.
18639869 Leukemia inhibitory factor: Role in human mesenchymal stem cells mediated immunosuppression.
18637760 2009 Leukemia inhibitory factor secretion is a predictor and indicator of early progenitor status in adult bone marrow stromal cells.
18540977 2008 Expression of leukaemia inhibitory factor in epithelial ovarian carcinoma: correlation with clinical characteristics.
18492704 2008 Leukemia inhibitory factor promotes human first trimester extravillous trophoblast adhesion to extracellular matrix and secretion of tissue inhibitor of metalloproteinases-1 and -2.
18468598 2009 Locally elevated leukemia inhibitory factor in the inflamed fallopian tube resembles that found in tubal pregnancy.
18317962 OSM, LIF, its receptors, and its relationship with the malignance in human breast carcinoma (in situ and in infiltrative).
18298054 2007 Association of the leukemia inhibitory factor gene mutation and the antiphospholipid antibodies in the peripheral blood of infertile women.
18258286 2008 Leukemia inhibitory factor (LIF) is immunohistochemically localized in tubal ectopic pregnancy.
18048043 2008 Placental stem cell markers in pre-eclampsia.
18047677 2007 Immunolocalisation of phosphorylated STAT3, interleukin 11 and leukaemia inhibitory factor in endometrium of women with unexplained infertility during the implantation window.
18042242 2008 Leukaemia inhibitory factor is over-expressed by ischaemic brain tissue concomitant with reduced plasma expression following acute stroke.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17979974 2008 Interleukin-6 cytokine family member oncostatin M is a hair-follicle-expressed factor with hair growth inhibitory properties.
17966612 2007 [The leukemia inhibitory factor gene mutations in the population of infertile women: the heterozygote transition G to A on the position 3400 does not affect the outcome of the infertility treatment].
17848619 2007 Tumor-associated leukemia inhibitory factor and IL-6 skew monocyte differentiation into tumor-associated macrophage-like cells.
17702963 2007 An interactive association of common sequence variants in the neuropeptide Y gene with susceptibility to ischemic stroke.
17681328 2008 Effects of ovarian stimulation on endometrial integrin beta3 and leukemia inhibitory factor expression in the peri-implantation phase.
17671691 2007 Induction of interleukin-8 (CXCL-8) by tumor necrosis factor-alpha and leukemia inhibitory factor in pancreatic carcinoma cells: Impact of CXCL-8 as an autocrine growth factor.
17652170 2007 An unusual cytokine:Ig-domain interaction revealed in the crystal structure of leukemia inhibitory factor (LIF) in complex with the LIF receptor.
17332938 2007 Leukemia inhibitory factor functions as a growth factor in pancreas carcinoma cells: Involvement of regulation of LIF and its receptor expression.
17054938 2006 The CNTF/LIF signaling pathway regulates developmental programmed cell death and differentiation of rod precursor cells in the mouse retina in vivo.
17000646 2006 Leukaemia inhibitory factor and interleukin 11 levels in uterine flushings of infertile patients with endometriosis.
16949591 2006 Expression of leukemia inhibitory factor and its receptors is increased during differentiation of human embryonic stem cells.
16759928 2006 Glycodelin is present in pinopodes of receptive-phase human endometrium and is associated with down-regulation of progesterone receptor B.
16648972 The migration of bone marrow-derived non-hematopoietic tissue-committed stem cells is regulated in an SDF-1-, HGF-, and LIF-dependent manner.
16545901 2006 Leukemia inhibitory factor gene mutations in the population of infertile women are not restricted to nulligravid patients.
16489116 2006 Increased secretion of leukemia inhibitory factor by immature airway smooth muscle cells enhances intracellular signaling and airway contractility.
16341766 2005 Leukemia inhibitory factor in follicular fluid is not related to the number and quality of embryos as well as implantation and pregnancy rates.
16295654 2005 Role of the leukemia-inhibitory factor gene mutations in infertile women: the embryo-endometrial cytokine cross talk during implantation--a delicate homeostatic equilibrium.
16263181 2006 No association of leukemia inhibitory factor (LIF) DNA polymorphisms with multiple sclerosis.
16051226 2005 The N-terminal cytokine binding domain of LIFR is required for CNTF binding and signaling.
15905624 2005 Human endometrial leukemia inhibitory factor and interleukin-6: control of secretion by transforming growth factor-beta-related members.
15837065 2005 Trophoblast invasion: tuning through LIF, signalling via Stat3.
15731310 2004 Leukemia inhibitory factor and human embryo implantation.
15670782 2005 Leukemia inhibitory factor induces multi-lineage differentiation of adult stem-like cells in kidney via kidney-specific cadherin 16.
15543003 2004 Tumor necrosis factor, interleukin 11, and leukemia inhibitory factor produced by Langerhans cells in Langerhans cell histiocytosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342941 2004 LIF/STAT3 signaling fails to maintain self-renewal of human embryonic stem cells.
15341921 2004 IL-1beta induction of IL-6 and LIF in normal articular human chondrocytes involves the ERK, p38 and NFkappaB signaling pathways.
15180980 2004 Expression of leukemia inhibitory factor and its receptor is not altered in the decidua and chorionic villi of human anembryonic pregnancy.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15044601 2004 Immunocytochemical detection and RT-PCR expression of leukaemia inhibitory factor and its receptor in human fetal and adult ovaries.
14715713 2004 Differential modulation of energy balance by leptin, ciliary neurotrophic factor, and leukemia inhibitory factor gene delivery: microarray deoxyribonucleic acid-chip analysis of gene expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14687743 2004 Leukaemia inhibitory factor (LIF) gene mutations in women with unexplained infertility and recurrent failure of implantation after IVF and embryo transfer.
14647442 2004 The human hepatocyte growth factor (HGF) gene is transcriptionally activated by leukemia inhibitory factor through the Stat binding element.
14557674 2004 Regulation of the human leukemia inhibitory factor gene by ETS transcription factors.
14527405 2003 Convergent mechanisms for recognition of divergent cytokines by the shared signaling receptor gp130.
12807438 2003 Gene expression in human neural stem cells: effects of leukemia inhibitory factor.
12764151 2003 Src family kinase-independent signal transduction and gene induction by leukemia inhibitory factor.
12707269 2003 Leukemia inhibitory factor (LIF), cardiotrophin-1, and oncostatin M share structural binding determinants in the immunoglobulin-like domain of LIF receptor.
12643274 2003 Signaling of human ciliary neurotrophic factor (CNTF) revisited. The interleukin-6 receptor can serve as an alpha-receptor for CTNF.
12601009 2003 Mutations in the immunoglobulin-like domain of gp190, the leukemia inhibitory factor (LIF) receptor, increase or decrease its affinity for LIF.
12579339 2003 Leukemia inhibitory factor regulates cell survival of normal human endometrial stromal cells.
12574225 2003 Leukemia inhibitory factor regulates prolactin secretion in prolactinoma and lactotroph cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218157 2002 IL-6, leukemia inhibitory factor, and oncostatin M stimulate bone resorption and regulate the expression of receptor activator of NF-kappa B ligand, osteoprotegerin, and receptor activator of NF-kappa B in mouse calvariae.
12153570 2002 N-myc oncogene overexpression down-regulates leukemia inhibitory factor in neuroblastoma.
11855863 2002 LIF-induced STAT3 signaling in murine versus human embryonal carcinoma (EC) cells.
11811789 2001 Oncostatin M and leukemia inhibitory factor regulate the growth of normal human breast epithelial cells.
11587067 2001 Linkage disequilibrium and haplotype analysis among four novel single-nucleotide polymorphisms in the human leukemia inhibitory factor (LIF) gene.
11448119 2001 Leukaemia inhibitory factor and interleukin 6 inhibit secretion of prolactin and growth hormone by rat pituitary MtT/SM cells.
10591208 1999 The DNA sequence of human chromosome 22.
10205054 1999 Synergistic signaling in fetal brain by STAT3-Smad1 complex bridged by p300.
9920829 1999 Reconstitution of the functional mouse oncostatin M (OSM) receptor: molecular cloning of the mouse OSM receptor beta subunit.
9847074 1998 Toward a complete human genome sequence.
9593715 1998 Solution structure of leukemia inhibitory factor.
9349722 1997 Molecular cloning of rat leukemia inhibitory factor receptor alpha-chain gene and its expression during pregnancy.
8999038 1996 Dual oncostatin M (OSM) receptors. Cloning and characterization of an alternative signaling subunit conferring OSM-specific receptor activation.
8489250 1993 Glycosylation pattern and disulfide assignments of recombinant human differentiation-stimulating factor.
8058719 1994 Leukemia inhibitory factor, a cytokine at the interface between neurobiology and immunology.
7957045 1994 Cloning of a murine IL-11 receptor alpha-chain; requirement for gp130 for high affinity binding and signal transduction.
7867561 1995 Inhibition of growth hormone-releasing factor production in mouse placenta by cytokines using gp130 as a signal transducer.
7508917 1994 Mitogen-activated protein kinases and ribosomal S6 protein kinases are involved in signaling pathways shared by interleukin-11, interleukin-6, leukemia inhibitory factor, and oncostatin M in mouse 3T3-L1 cells.
3143918 1988 Leukaemia inhibitory factor is identical to the myeloid growth factor human interleukin for DA cells.
3143916 1988 Myeloid leukaemia inhibitory factor maintains the developmental potential of embryonic stem cells.
3128791 1988 Molecular cloning and expression of the human homologue of the murine gene encoding myeloid leukemia-inhibitory factor.
2730639 1989 Purification of a lipoprotein lipase-inhibiting protein produced by a melanoma cell line associated with cancer cachexia.
2491897 1989 The gene for human leukemia inhibitory factor (LIF) maps to 22q12.
2475312 1989 Genomic cloning and heterologous expression of human differentiation-stimulating factor.
1714745 1991 Neuropoietic cytokines in the hematopoietic fold.
1692837 1990 Structural organization of the genes for murine and human leukemia inhibitory factor. Evolutionary conservation of coding and non-coding regions.