Property Summary

NCBI Gene PubMed Count 21
PubMed Score 36.89
PubTator Score 23.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.200 3.1e-02
astrocytic glioma -1.100 7.7e-03
Astrocytoma, Pilocytic -1.300 2.0e-03
atypical teratoid / rhabdoid tumor -1.200 2.7e-02
breast carcinoma -1.100 1.3e-03
ependymoma -1.400 7.8e-04
glioblastoma -1.200 4.6e-04
group 3 medulloblastoma -1.600 3.4e-02
interstitial cystitis 1.900 6.6e-05
intraductal papillary-mucinous adenoma (... -1.300 3.5e-04
intraductal papillary-mucinous carcinoma... -1.400 2.0e-04
intraductal papillary-mucinous neoplasm ... -1.100 9.7e-03
invasive ductal carcinoma -1.400 1.4e-03
oligodendroglioma -1.100 1.2e-19
osteosarcoma 1.199 1.5e-04

Gene RIF (9)

AA Sequence

MAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGALDKDEGQASPCTPSTPSVCSPPSAASSVPSAGKNIC      1 - 70
SSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRFGTKCARCGRQIYA     71 - 140
SDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGAVPS    141 - 210
EQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQ    211 - 280
HPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGP    281 - 350
LSNRGEKVILFQY                                                             351 - 363
//

Text Mined References (21)

PMID Year Title