Property Summary

NCBI Gene PubMed Count 21
PubMed Score 46.89
PubTator Score 47.56

Knowledge Summary

Patent

No data available

 GO Component (2)

Gene RIF (8)

PMID Text
23954021 Data have identified TBX6 as a new gene associated with Mullerian aplasia. The results also support the relevance of LHX1 and CNVs in the development of this congenital malformation.
22875024 Data indicate that expression of ERAS, LHX1, and CCRK is increased in aggressive subgroups of medulloblastomas.
22740494 study concludes that heterozygous mutations of LHX1 might be one cause of the Mayer-Rokitansky-Kuster-Hauser syndrome in a subgroup of patients
22231913 Lim1/LIM1 expression in neonatal, adult mouse and human endometrium suggesting Lim1/LIM1 may have a role in endometrial development and remodelling
22217964 Mutations in the coding regions of LHX1 may not be a common genetic etiologic factor involved in Han Chinese patients with mullerian duct abnormalities.
21778788 Eleven dysplastic kidneys showed no expression of LIM1. In contrast, 12 of 32 nephroblastomas showed nuclear positivity.
21132009 findings establish that the developmental marker Lim1 acts as an oncogene in cancer cells and targeting Lim1 may constitute an innovative therapeutic intervention in human lear cell carcinoma
19849868 Lim1 (also known as Lhx1) gene consists of a DNA-binding homeodomain and 2 cysteine-rich LIM domains, which may participate in protein to protein interactions, and encodes a transcription factor.

AA Sequence

MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGI      1 - 70
SPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSSVAKENSLHSATTGSDPS     71 - 140
LSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIR    141 - 210
EQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYG    211 - 280
DYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHP    281 - 350
PGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW                  351 - 406
//

Text Mined References (21)

PMID Year Title
23954021 2013 TBX6, LHX1 and copy number variations in the complex genetics of Müllerian aplasia.
22875024 2012 Functional genomics identifies drivers of medulloblastoma dissemination.
22740494 2012 Frame shift mutation of LHX1 is associated with Mayer-Rokitansky-Kuster-Hauser (MRKH) syndrome.
22231913 2012 Lim1/LIM1 is expressed in developing and adult mouse and human endometrium.
22217964 2012 LHX1 mutation screening in 96 patients with müllerian duct abnormalities.
21778788 2011 Lim1, an embryonal transcription factor, is absent in multicystic renal dysplasia, but reactivated in nephroblastomas.
21132009 2011 LIM-class homeobox gene Lim1, a novel oncogene in human renal cell carcinoma.
20797712 2011 Recurrent aberrations identified by array-CGH in patients with Mayer-Rokitansky-Küster-Hauser syndrome.
19889212 2009 Recurrent microdeletion at 17q12 as a cause of Mayer-Rokitansky-Kuster-Hauser (MRKH) syndrome: two case reports.
19849868 2009 The role of genes in the development of Mullerian anomalies: where are we today?
19615554 2009 Cell and molecular biology of kidney development.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16022279 2005 LIM-homeodomain genes in mammalian development and human disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438757 2002 Assignment of LHX1 to human chromosome bands 17q11.2-->q12 by use of radiation hybrid mapping and somatic cell hybridization.
11882901 2002 Ubiquitination-dependent cofactor exchange on LIM homeodomain transcription factors.
9890059 1998 Genetic control of gonadal differentiation.
9452425 1998 The nuclear LIM domain interactor NLI mediates homo- and heterodimerization of LIM domain transcription factors.
9212161 1997 Cloning, expression, and chromosomal localization to 11p12-13 of a human LIM/HOMEOBOX gene, hLim-1.
8954926 1996 The exon-intron structure of human LHX1 gene.