Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.99
PubTator Score 0.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.100 9.1e-04
glioblastoma 2.000 1.3e-04
tuberculosis -2.400 2.5e-06
pediatric high grade glioma 1.200 1.5e-04
pilocytic astrocytoma 1.600 1.2e-10
sonic hedgehog group medulloblastoma 1.400 3.8e-06
subependymal giant cell astrocytoma 1.558 1.7e-02
lung carcinoma -2.000 6.8e-24
gastric carcinoma 1.100 1.6e-02

Protein-protein Interaction (11)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15905332 The authors present an overview of the LHFP gene family in mouse and humans

AA Sequence

MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRN      1 - 70
PGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQ     71 - 140
GIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATS    141 - 210
SDKVQEEIEEGKNLICLL                                                        211 - 228
//

Text Mined References (12)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15905332 2005 A missense mutation in the previously undescribed gene Tmhs underlies deafness in hurry-scurry (hscy) mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10329012 1999 LHFP, a novel translocation partner gene of HMGIC in a lipoma, is a member of a new family of LHFP-like genes.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.