Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.67
PubTator Score 7.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 2.6e-06
lung cancer 4473 5.0e-05
non-small cell lung cancer 2798 8.2e-04
Disease Target Count Z-score Confidence
Mucopolysaccharidosis IV 5 3.941 2.0
Gaucher's disease 25 3.439 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer 1.120 8.2e-04
lung cancer 2.500 5.0e-05
lung adenocarcinoma 1.600 2.6e-06

Synonym

Accession Q5TDP6 A1L421 Q0PVN9 Q0PVP0 Q9NYJ0
Symbols LGS
GLULD1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (6)

PMID Text
21621269 In major depressive disorder genome-wide association study, best male-specific SNP was rs9362774 within LGSN gene
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19459848 Novel spliced form of a lens protein as a novel lung cancer antigen, Lengsin splicing variant 4, is reported.
17161372 Lengsin belongs to the predominantly prokaryotic class 1 branch of glutamine synthetases but has lost enzyme activity
17010935 A potential chaperone-like role of Lengsin was investigated.
12107413 Lengsin is major novel protein of the vertebrate eye lens.

AA Sequence

MNNEEDLLQEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMRDSSQILTPPQLS      1 - 70
SRMKHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFFQEKVSHGVCMPRGYLEVIPNPKDNEMNNIRA     71 - 140
TCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPRYIAKRQLSHLQASGFSLLSAFIYDF    141 - 210
CIFGVPEILNSKIISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSAD    211 - 280
NAFTLRTGVKEVARKYNYIASFFIETGFCDSGILSHSLWDVDRKKNMFCSTSGTEQLTITGKKWLAGLLK    281 - 350
HSAALSCLMAPSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCHGEKGTRIENKLGSATANPYLVL    351 - 420
AATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETFIRYFVAMKKY    421 - 490
ELENEEIAAERNKFLEYFI                                                       491 - 509
//

Text Mined References (13)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21621269 2011 Genome-wide association analysis of gender differences in major depressive disorder in the Netherlands NESDA and NTR population-based samples.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19459848 2009 Novel spliced form of a lens protein as a novel lung cancer antigen, Lengsin splicing variant 4.
17161372 2006 Lengsin is a survivor of an ancient family of class I glutamine synthetases re-engineered by evolution for a role in the vertebrate lens.
17010935 2006 Structural and functional properties of lengsin, a pseudo-glutamine synthetase in the transparent human lens.
16273301 2005 Mutation screening of three candidate genes, ELOVL5, SMAP1 and GLULD1 in autosomal recessive retinitis pigmentosa.
16005676 2006 The NEIBank project for ocular genomics: data-mining gene expression in human and rodent eye tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.