Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.89
PubTator Score 7.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.600 2.6e-06
lung cancer 1.100 6.2e-03
non-small cell lung cancer 1.120 8.2e-04

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (6)

AA Sequence

MNNEEDLLQEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMRDSSQILTPPQLS      1 - 70
SRMKHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFFQEKVSHGVCMPRGYLEVIPNPKDNEMNNIRA     71 - 140
TCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPRYIAKRQLSHLQASGFSLLSAFIYDF    141 - 210
CIFGVPEILNSKIISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSAD    211 - 280
NAFTLRTGVKEVARKYNYIASFFIETGFCDSGILSHSLWDVDRKKNMFCSTSGTEQLTITGKKWLAGLLK    281 - 350
HSAALSCLMAPSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCHGEKGTRIENKLGSATANPYLVL    351 - 420
AATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETFIRYFVAMKKY    421 - 490
ELENEEIAAERNKFLEYFI                                                       491 - 509
//

Text Mined References (13)

PMID Year Title