Property Summary

NCBI Gene PubMed Count 12
PubMed Score 22.52
PubTator Score 60.12

Knowledge Summary

Patent (12,734)

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma -2.100 1.2e-04
Multiple Sclerosis 1.200 2.7e-02
posterior fossa group B ependymoma 1.200 5.4e-03
non-inflammatory breast cancer -1.900 9.7e-06
breast carcinoma -1.200 4.1e-20
ovarian cancer 2.200 3.9e-04
pituitary cancer -1.700 2.1e-04

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human leucine-rich repeat containing G protein-coupled receptor 6 (LGR6) at amino acid residues 202-203 by the HIV-1 protease
22615920 Overexpression of wild-type LGR6 in HeLa cells leads to increased cell migration.

AA Sequence

MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAVPGDLDPLTAY      1 - 70
LDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSL     71 - 140
QSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLT    141 - 210
SLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGN    211 - 280
PLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQ    281 - 350
LPRLRVLELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFST    351 - 420
LHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCCPYGMCASFFK    421 - 490
ASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPHPSVQCSPTPGPFKPCEYLFE    491 - 560
SWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFVVGAIAGANTLTGISCGLLASVDALTFGQFS    561 - 630
EYGARWETGLGCRATGFLAVLGSEASVLLLTLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLA    631 - 700
AALPLASVGEYGASPLCLPYAPPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCA    701 - 770
MVRHVAWLIFADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR    771 - 840
LRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVTLISCQQPGAP    841 - 910
RLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSGLAFASHV                 911 - 967
//

Text Mined References (13)

PMID Year Title
25456346 2015 Genomic predictors of combat stress vulnerability and resilience in U.S. Marines: A genome-wide association study across multiple ancestries implicates PRTFDC1 as a potential PTSD gene.
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
22615920 2012 LGR6 is a high affinity receptor of R-spondins and potentially functions as a tumor suppressor.
21727895 2011 Lgr5 homologues associate with Wnt receptors and mediate R-spondin signalling.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
10935549 2000 The three subfamilies of leucine-rich repeat-containing G protein-coupled receptors (LGR): identification of LGR6 and LGR7 and the signaling mechanism for LGR7.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.