Property Summary

NCBI Gene PubMed Count 26
PubMed Score 61.35
PubTator Score 32.95

Knowledge Summary

Patent (6,748)

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -2.400 3.2e-08
psoriasis -1.100 3.8e-07
osteosarcoma 1.115 4.2e-02
atypical teratoid / rhabdoid tumor -1.200 6.9e-05
glioblastoma -1.300 3.8e-05
medulloblastoma, large-cell -1.800 3.7e-03
adrenocortical carcinoma -1.039 2.1e-02
non-small cell lung cancer 2.441 7.0e-30
lung cancer 1.500 6.6e-03
breast carcinoma -1.300 1.2e-05
interstitial cystitis -1.800 1.7e-03
lung adenocarcinoma 1.771 1.3e-04
adult high grade glioma -1.700 2.3e-04
aldosterone-producing adenoma -1.443 2.1e-02
Breast cancer -2.500 5.7e-09
lung carcinoma 1.900 8.1e-23
spina bifida -1.495 2.2e-02

Protein-protein Interaction (12)

Gene RIF (18)

PMID Text
25636507 LGR4 promotes tumorigenesis of prostate cancer via PI3K/Akt signaling pathway.
25531322 These findings suggest that aberrant RSPO3-LGR4 signaling potentially acts as a driving mechanism in the aggressiveness of Keap1-deficient lung ADs.
25480784 the LGR4-Rspo1 complex crystal structure shows divergent mechanisms of ligand recognition by leucine-rich repeat G-protein-coupled receptors
24639526 RSPO-LGR4 not only induces the clearance of RNF43/ZNRF3 to increase Wnt receptor levels but also recruits IQGAP1 into the Wnt signaling complex.
24519938 Lgr4, which regulates eye, kidney, testis, ovary, and uterine organ development as well as mental development through genetic and epigenetic surveillance, is a novel candidate gene for the pathogenesis of AGR syndrome
24455684 our results suggest a previously unknown Stat3-LGR4 molecular network, which may control osteosarcoma development and progression
24212090 A functional low-frequency human LGR4 variant (A750T) has been associated with body mass index in a Chinese obese-versus-control study.
24083766 Lgr4 overexpression promoted glioma cell proliferation through activation of Wnt signaling.
24083742 GPR48 overexpression promotes cancer cell proliferation via activation of Wnt signaling.
23803691 Upregulation of GPR48 resulted in increased phosphorylation of glycogen synthase kinase 3beta.
23644456 the c.376C>T mutation is associated with low BMD and osteoporotic fractures, electrolyte imbalance, late onset of menarche, reduced testosterone levels, and an increased risk of squamous cell carcinoma of the skin and biliary tract cancer
23589304 Lgr4/Gpr48 plays a critical role in modulating the TLR2/4 signaling pathway and represents a useful therapeutic approach of targeting Lgr4/Gpr48 in TLR2/4-associated septic shock and autoimmune diseases.
23444378 Multi-functional norrin is a ligand for the LGR4 receptor.
22815884 R-Spondin potentiates Wnt/beta-catenin signaling through orphan receptors LGR4 and LGR5
21693646 LGR4 and LGR5 bind the R-spondins with high affinity and mediate the potentiation of Wnt/beta-catenin signaling by enhancing Wnt-induced LRP6 phosphorylation.
19550120 Data show that GPR48 shRNA can inhibit in vitro invasion and in vivo metastasis of HeLa cells efficiently.
19301269 Testicular efferent ducts in the mutant mouse are dramatically shortened and less convoluted than in the wild-type animal, providing an explanation to the phenotype observed in LGR4KO.
17178856 GPR48 may play an important role in invasiveness and metastasis of carcinoma and might represent a potential prognostic marker or therapeutic target.

AA Sequence

MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNIT      1 - 70
QLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANH     71 - 140
ITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHN    141 - 210
NKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLY    211 - 280
DNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDL    281 - 350
SYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV    351 - 420
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQ    421 - 490
DHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLTVWFIFLVALFFNLLVI    491 - 560
LTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAVSWGRFAEFGIWWETGSGCKVAGFLAVFSSE    561 - 630
SAIFLLMLATVERSLSAKDIMKNGKSNHLKQFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGE    631 - 700
TPSLGFTVTLVLLNSLAFLLMAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAP    701 - 770
LITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD    771 - 840
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDYAD    841 - 910
EEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD                                 911 - 951
//

Text Mined References (31)

PMID Year Title
25636507 2015 GPCR48/LGR4 promotes tumorigenesis of prostate cancer via PI3K/Akt signaling pathway.
25531322 2015 Aberrant RSPO3-LGR4 signaling in Keap1-deficient lung adenocarcinomas promotes tumor aggressiveness.
25480784 2015 Crystal structure of LGR4-Rspo1 complex: insights into the divergent mechanisms of ligand recognition by leucine-rich repeat G-protein-coupled receptors (LGRs).
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24639526 2014 RSPO-LGR4 functions via IQGAP1 to potentiate Wnt signaling.
24519938 2014 LGR4/GPR48 inactivation leads to aniridia-genitourinary anomalies-mental retardation syndrome defects.
24455684 2013 Stat3 upregulates leucine-rich repeat-containing g protein-coupled receptor 4 expression in osteosarcoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24212090 2013 Ablation of LGR4 promotes energy expenditure by driving white-to-brown fat switch.
24083766 2013 Lgr4 promotes glioma cell proliferation through activation of Wnt signaling.
24083742 2013 GPR48 promotes multiple cancer cell proliferation via activation of Wnt signaling.
23803691 2013 GPR48, a poor prognostic factor, promotes tumor metastasis and activates ?-catenin/TCF signaling in colorectal cancer.
23756652 2013 Structural basis for R-spondin recognition by LGR4/5/6 receptors.
23644456 2013 Nonsense mutation in the LGR4 gene is associated with several human diseases and other traits.
23589304 2013 Lgr4/Gpr48 negatively regulates TLR2/4-associated pattern recognition and innate immunity by targeting CD14 expression.
23444378 2013 Multi-functional norrin is a ligand for the LGR4 receptor.
22815884 2012 R-Spondin potentiates Wnt/?-catenin signaling through orphan receptors LGR4 and LGR5.
21909076 2011 LGR4 and LGR5 are R-spondin receptors mediating Wnt/?-catenin and Wnt/PCP signalling.
21727895 2011 Lgr5 homologues associate with Wnt receptors and mediate R-spondin signalling.
21693646 2011 R-spondins function as ligands of the orphan receptors LGR4 and LGR5 to regulate Wnt/beta-catenin signaling.
19550120 2009 Inhibitory effect of shRNA targeting GPR48 on invasion and metastasis of human cervical carcinoma cell line HeLa.
19301269 2009 Three-dimensional reconstruction of efferent ducts in wild-type and Lgr4 knock-out mice.
18424556 2008 Deletion of G protein-coupled receptor 48 leads to ocular anterior segment dysgenesis (ASD) through down-regulation of Pitx2.
17178856 2006 Up-regulation of GPR48 induced by down-regulation of p27Kip1 enhances carcinoma cell invasiveness and metastasis.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11401528 2001 Molecular characterization of a novel glycoprotein hormone G-protein-coupled receptor.
10894923 2000 Chromosomal localization of GPR48, a novel glycoprotein hormone receptor like GPCR, in human and mouse with radiation hybrid and interspecific backcross mapping.
9849958 1998 Characterization of two LGR genes homologous to gonadotropin and thyrotropin receptors with extracellular leucine-rich repeats and a G protein-coupled, seven-transmembrane region.