Property Summary

Ligand Count 68
NCBI Gene PubMed Count 52
PubMed Score 233.23
PubTator Score 69.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -1.100 2.0e-02
acute quadriplegic myopathy 1.372 4.9e-06
Becker muscular dystrophy 1.013 3.3e-04
cutaneous lupus erythematosus 1.700 2.2e-03
dermatomyositis 1.300 7.1e-03
diabetes mellitus -1.600 6.2e-03
Duchenne muscular dystrophy 1.706 1.1e-10
glioblastoma 1.600 3.3e-02
intraductal papillary-mucinous adenoma (... 1.200 3.4e-02
juvenile dermatomyositis 1.439 6.0e-12
limb girdle muscular dystrophy 2A 1.258 2.5e-07
malignant mesothelioma -1.600 5.8e-07
ovarian cancer -1.800 1.1e-06
psoriasis 1.300 2.0e-03
tuberculosis -2.600 2.6e-08

 IMPC Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

PDB (10)

Gene RIF (36)

AA Sequence

MVWKVAVFLSVALGIGAVPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMM      1 - 70
YDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQDH     71 - 140
VFIYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAA    141 - 210
NPRESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKV    211 - 280
MQFQGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVR    281 - 350
KIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHR    351 - 420
IKLSMDHVCLGHY                                                             421 - 433
//

Text Mined References (56)

PMID Year Title