Property Summary

NCBI Gene PubMed Count 45
PubMed Score 208.15
PubTator Score 69.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.600 5.8e-07
cutaneous lupus erythematosus 1.700 2.2e-03
psoriasis 1.300 2.0e-03
glioblastoma 1.600 3.3e-02
Duchenne muscular dystrophy 1.706 1.1e-10
limb girdle muscular dystrophy 2A 1.258 2.5e-07
Becker muscular dystrophy 1.013 3.3e-04
juvenile dermatomyositis 1.439 6.0e-12
acute quadriplegic myopathy 1.372 4.9e-06
tuberculosis -2.600 2.6e-08
intraductal papillary-mucinous adenoma (... 1.200 3.4e-02
diabetes mellitus -1.600 6.2e-03
acute myeloid leukemia -1.100 2.0e-02
ovarian cancer 2.800 1.4e-05
dermatomyositis 1.300 7.1e-03

Gene RIF (29)

PMID Text
26802645 legumain might play an important role in cervical cancer cell migration and invasion.
26607955 Legumain appears to be involved in tumor development and deterioration.
26549211 AEP acts as a delta-secretase, cleaving APP at N373 and N585 residues, selectively influencing the amyloidogenic fragmentation of APP. AEP contributes to the age-dependent pathogenic mechanisms in Alzheimer disease.
26403494 Studies indicate that legumain, usually in lysosomes, is also found extracellularly and even translocates to the cytosol and the nucleus.
25605174 High legumain expression is associated with breast cancer.
25326800 AEP acts as a crucial mediator of tau-related clinical and neuropathological changes.
24742492 High legumain activity is associated with breast cancer.
24610907 Identified an alternative oncogenic pathway for TRAF6 that uses AEP as its substrate. AEP and TRAF6 protein levels may have prognostic implications in breast cancer patients. Thus, AEP may serve as a biomarker as well as new therapeutic target
24407422 This unique feature was confirmed by the crystal structure of AEPpH4.5 (AEP was matured at pH 4.5 and crystallized at pH 8.5), in which the broken peptide bonds were religated and the structure was transformed back to its proenzyme form.
24023813 the relationship among Legumain expression, clinicopathologic, biological variables and patient prognosis in gastric carcinoma
23942113 HCT116 cells were transfected with p53 siRNA and the effect of knockdown of p53 expression on legumain expression was examined. The results showed that expression levels of both legumain mRNA and protein were decreased in the siRNA-treated cells.
23776206 The multibranched and context-dependent activation process of legumain illustrates how proteases can act not only as signal transducers but as decision makers.
23640887 Involvement of brain acidosis in the etiopathogenesis of Alzheimer disease, and the asparaginyl endopeptidase-I2(PP2A)-protein phosphatase 2A-Tau hyperphosphorylation pathway.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of legumain (LGMN) in peptide-treated PBMCs
23326369 In the HCT116 and SW620 cell lines nuclear Data indicate that legumain was found to make up approximately 13% and 17% of the total legumain, respectively.
23160071 glycosaminoglycans accelerated the autocatalytic activation of prolegumain
23124822 Prostate cancer with a vesicular staining pattern of legumain had the potential of being highly invasive and aggressive in patients treated with radical prostatectomy. This suggests that legumain might contribute to the invasiveness and aggressiveness.
22902879 Data show a regulatory role of cystatin E/M in controlling both intra- and extracellular legumain activity.
22718532 TDP-43 is cleaved by AEP in brain.
22441772 Increased legumain expression was validated by real-time PCR and Western blots, correlated positively with an increased malignancy of ovarian tumors.
22232165 Accepting asparagines and, to lesser extent, aspartic acid in P1, super-activated legumain exhibits a marked pH dependence that is governed by the P1 residue of its substrate and conformationally stabilizing factors such as temperature or ligands
20536387 The Lgmn can serve as novel target in diabetes mellitus genetic therapy.
20074384 the level of cystatin E/M regulates legumain activity and hence the invasive potential of human melanoma cells
19453521 GARP is a key receptor controlling FOXP3 in T(reg) cells following T-cell activation in a positive feedback loop assisted by LGALS3 and LGMN
18377911 Legumain is expressed in both murine and human atherosclerotic lesions, may play a functional role in atherogenesis
18374643 AEP may be a proteinases activated by acidosis triggering neuronal injury during neuroexcitotoxicity or ischemia.
15788679 Increased legumain expression is associated with primary colorectal cancer
15100291 Freshly isolated human B lymphocytes lack significant asparagine-specific endoprotease (AEP/legumain) activity; cleavage by AEP is dispensable for proteolytic processing of myelin basic protein in this type of cell.
12860980 human monocyte-derived dendritic cells harbor inactive proforms of AEP (legumain) that become activated upon maturation of dendritic cells with lipopolysaccharide

AA Sequence

MVWKVAVFLSVALGIGAVPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIVVMM      1 - 70
YDDIAYSEDNPTPGIVINRPNGTDVYQGVPKDYTGEDVTPQNFLAVLRGDAEAVKGIGSGKVLKSGPQDH     71 - 140
VFIYFTDHGSTGILVFPNEDLHVKDLNETIHYMYKHKMYRKMVFYIEACESGSMMNHLPDNINVYATTAA    141 - 210
NPRESSYACYYDEKRSTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKV    211 - 280
MQFQGMKRKASSPVPLPPVTHLDLTPSPDVPLTIMKRKLMNTNDLEESRQLTEEIQRHLDARHLIEKSVR    281 - 350
KIVSLLAASEAEVEQLLSERAPLTGHSCYPEALLHFRTHCFNWHSPTYEYALRHLYVLVNLCEKPYPLHR    351 - 420
IKLSMDHVCLGHY                                                             421 - 433
//

Text Mined References (49)

PMID Year Title
26802645 2016 Knockdown of Legumain Suppresses Cervical Cancer Cell Migration and Invasion.
26607955 2015 Clinicopathologic significance of legumain overexpression in cancer: a systematic review and meta-analysis.
26549211 2015 Delta-secretase cleaves amyloid precursor protein and regulates the pathogenesis in Alzheimer's disease.
26403494 2016 Structure and function of legumain in health and disease.
25605174 2014 Legumain protein as a potential predictive biomarker for Asian patients with breast carcinoma.
25326800 2014 Cleavage of tau by asparagine endopeptidase mediates the neurofibrillary pathology in Alzheimer's disease.
24742492 2014 TBX2 represses CST6 resulting in uncontrolled legumain activity to sustain breast cancer proliferation: a novel cancer-selective target pathway with therapeutic opportunities.
24610907 2014 Functional role of asparaginyl endopeptidase ubiquitination by TRAF6 in tumor invasion and metastasis.
24407422 2014 Structural analysis of asparaginyl endopeptidase reveals the activation mechanism and a reversible intermediate maturation stage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023813 2013 Expression of legumain correlates with prognosis and metastasis in gastric carcinoma.
23942113 2013 Transcriptional regulation of the legumain gene by p53 in HCT116 cells.
23776206 2013 Mechanistic and structural studies on legumain explain its zymogenicity, distinct activation pathways, and regulation.
23640887 2013 Activation of asparaginyl endopeptidase leads to Tau hyperphosphorylation in Alzheimer disease.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23326369 2013 Nuclear legumain activity in colorectal cancer.
23160071 2013 Autoactivation of prolegumain is accelerated by glycosaminoglycans.
23124822 2013 Association of legumain expression pattern with prostate cancer invasiveness and aggressiveness.
22902879 2012 Intra- and extracellular regulation of activity and processing of legumain by cystatin E/M.
22718532 2012 Asparaginyl endopeptidase cleaves TDP-43 in brain.
22441772 2012 Legumain: a biomarker for diagnosis and prognosis of human ovarian cancer.
22232165 2012 Activation of legumain involves proteolytic and conformational events, resulting in a context- and substrate-dependent activity profile.
21269460 2011 Initial characterization of the human central proteome.
20536387 2010 Isolation of genes involved in pancreas regeneration by subtractive hybridization.
20074384 2010 Cystatin E/M suppresses legumain activity and invasion of human melanoma.
19453521 2009 GARP: a key receptor controlling FOXP3 in human regulatory T cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18377911 2008 Expression of the cysteine protease legumain in vascular lesions and functional implications in atherogenesis.
18374643 2008 Neuroprotective actions of PIKE-L by inhibition of SET proteolytic degradation by asparagine endopeptidase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15951480 2005 Vitamin D.
15788679 2005 Legumain expression in relation to clinicopathologic and biological variables in colorectal cancer.
15583024 2004 Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15100291 2004 Cathepsin G, and not the asparagine-specific endoprotease, controls the processing of myelin basic protein in lysosomes from human B lymphocytes.
12860980 2003 Multistep autoactivation of asparaginyl endopeptidase in vitro and in vivo.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11085925 2000 Activation of human prolegumain by cleavage at a C-terminal asparagine residue.
9891971 1998 Identification of the active site of legumain links it to caspases, clostripain and gingipains in a new clan of cysteine endopeptidases.
9872320 1998 An asparaginyl endopeptidase processes a microbial antigen for class II MHC presentation.
9821970 1998 Autocatalytic activation of human legumain at aspartic acid residues.
9742219 1998 Cloning and expression of mouse legumain, a lysosomal endopeptidase.
9065484 1997 Cloning, isolation, and characterization of mammalian legumain, an asparaginyl endopeptidase.
8893817 1996 Molecular cloning of a human cDNA encoding putative cysteine protease (PRSC1) and its chromosome assignment to 14q32.1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
136644 1976 Studies on the biological role of DNA methylation. II. Role of phiX174 DNA methylation in the process of viral progeny DNA synthesis.