Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.52
PubTator Score 6.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 2.2e-05
astrocytic glioma -1.400 2.7e-03
atypical teratoid / rhabdoid tumor -1.800 3.7e-09
Breast cancer -2.300 3.5e-02
breast carcinoma -1.500 1.7e-04
fibroadenoma -1.500 1.0e-02
glioblastoma -1.300 1.3e-07
group 3 medulloblastoma -1.500 3.4e-03
medulloblastoma, large-cell -1.800 7.1e-06
oligodendroglioma -1.100 1.2e-02
primitive neuroectodermal tumor -1.200 2.5e-02

Gene RIF (8)

AA Sequence

MGGAGILLLLLAGAGVVVAWRPPKGKCPLRCSCSKDSALCEGSPDLPVSFSPTLLSLSLVRTGVTQLKAG      1 - 70
SFLRIPSLHLLLFTSNSFSVIEDDAFAGLSHLQYLFIEDNEIGSISKNALRGLRSLTHLSLANNHLETLP     71 - 140
RFLFRGLDTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASVGTGACAGPASLSHMQLHHLDPKTFKCRAIE    141 - 210
LSWFQTVGESALSVEPFSYQGEPHIVLAQPFAGRCLILSWDYSLQRFRPEEELPAASVVSCKPLVLGPSL    211 - 280
FVLAARLWGGSQLWARPSPGLRLAPTQTLAPRRLLRPNDAELLWLEGQPCFVVADASKAGSTTLLCRDGP    281 - 350
GFYPHQSLHAWHRDTDAEALELDGRPHLLLASASQRPVLFHWTGGRFERRTDIPEAEDVYATRHFQAGGD    351 - 420
VFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGAHVFQPLLIARDQLAILGSDFAFSQVLRLEPDKGLLEP    421 - 490
LQELGPPALVAPRAFAHITMAGRRFLFAACFKGPTQIYQHHEIDLSA                           491 - 537
//

Text Mined References (12)

PMID Year Title