Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.42
PubTator Score 5.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -1.300 6.0e-13
ependymoma -2.300 6.5e-15
glioblastoma -2.200 5.2e-09
oligodendroglioma -1.400 7.9e-12
osteosarcoma 1.031 1.4e-05
group 3 medulloblastoma -3.600 1.3e-06
atypical teratoid/rhabdoid tumor -2.600 5.1e-12
medulloblastoma, large-cell -2.100 4.3e-05
primitive neuroectodermal tumor -2.100 1.4e-05
non-small cell lung cancer -1.534 1.8e-26
lung adenocarcinoma -1.200 3.9e-12
pediatric high grade glioma -2.200 3.2e-08
pilocytic astrocytoma -1.900 3.9e-06
subependymal giant cell astrocytoma -1.894 1.5e-02
lung carcinoma -1.100 9.9e-16
psoriasis -1.500 3.7e-29

Gene RIF (2)

PMID Text
24903553 Leucine-rich glioma inactivated 3 is a cytokine in human skin that promotes melanin production.
23815230 LGI3 was mostly expressed in the granular layer of the epidermis of human skin.

AA Sequence

MAGLRARGGPGPGLLALSALGFCLMLQVSAKRPPKTPPCPPSCSCTRDTAFCVDSKAVPRNLPSEVISLT      1 - 70
LVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFTGLSHLQYLFIENNDIWALSKFTFRGLKSLTH     71 - 140
LSLANNNLQTLPRDIFRPLDILNDLDLRGNSLNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQD    141 - 210
LPLREFDCITTDFVLYQTLAFPAVSAEPFLYSSDLYLALAQPGVSACTILKWDYVERQLRDYDRIPAPSA    211 - 280
VHCKPMVVDSQLYVVVAQLFGGSYIYHWDPNTTRFTRLQDIDPQRVRKPNDLEAFRIDGDWYFAVADSSK    281 - 350
AGATSLYRWHQNGFYSHQALHPWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQGEVTQV    351 - 420
PDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGRRYLALGSDFSFT    421 - 490
QIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHIVVDLSA                491 - 548
//

Text Mined References (12)

PMID Year Title
24903553 2014 Leucine-rich glioma inactivated 3 is a melanogenic cytokine in human skin.
23815230 Leucine-rich glioma inactivated 3 promotes HaCaT keratinocyte migration.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
18628660 2008 Leucine-rich glioma inactivated 3 is involved in amyloid beta peptide uptake by astrocytes and endocytosis itself.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12217514 2002 The novel EPTP repeat defines a superfamily of proteins implicated in epileptic disorders.
12095917 2002 A common protein interaction domain links two recently identified epilepsy genes.
12023020 2002 The LGI1 gene involved in lateral temporal lobe epilepsy belongs to a new subfamily of leucine-rich repeat proteins.