Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.39
PubTator Score 4.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.400 1.5e-02
atypical teratoid / rhabdoid tumor 1.400 8.5e-04
colon cancer -2.200 3.4e-02
ependymoma -1.300 2.7e-02
gastric cancer 1.100 7.1e-03
invasive ductal carcinoma -1.166 2.4e-04
lung adenocarcinoma -1.200 2.1e-09
malignant mesothelioma 1.200 3.9e-05
mucosa-associated lymphoid tissue lympho... 2.475 6.4e-03
non-small cell lung cancer -1.284 1.1e-10
pancreatic cancer 1.500 5.8e-03
pancreatic carcinoma 1.500 5.8e-03
periodontitis -1.100 3.8e-31
pituitary cancer -2.000 3.9e-04
spina bifida -1.473 2.3e-02
subependymal giant cell astrocytoma -1.257 3.9e-02

Gene RIF (3)

AA Sequence

MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAIS      1 - 70
LTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVD     71 - 140
GHQLFDFYHRIQTLSAIDTIKINGDLQITKLG                                          141 - 172
//

Text Mined References (19)

PMID Year Title