Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.36
PubTator Score 4.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
gastric cancer 1.100 7.1e-03
pancreatic cancer 1.500 5.8e-03
malignant mesothelioma 1.200 3.9e-05
astrocytic glioma -1.400 1.5e-02
posterior fossa group B ependymoma -1.400 1.6e-05
periodontitis -1.100 3.8e-31
atypical teratoid / rhabdoid tumor 1.400 8.5e-04
non-small cell lung cancer -1.284 1.1e-10
colon cancer -2.200 3.4e-02
lung adenocarcinoma -1.900 1.3e-08
pancreatic carcinoma 1.500 5.8e-03
subependymal giant cell astrocytoma -1.257 3.9e-02
invasive ductal carcinoma -1.166 2.4e-04
spina bifida -1.473 2.3e-02
mucosa-associated lymphoid tissue lympho... 2.475 6.4e-03
pituitary cancer -2.000 3.9e-04

Synonym

Accession Q3ZCW2 B2RBG8 D6W5E8 Q6P5T6 Q9P005
Symbols GRP
HSPC159

Gene

PANTHER Protein Class (1)

PDB

2JJ6   3B9C  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
18320588 Galectin-related protein is a novel protein that has a close similarity to galectin sequences but is not a member of the galectin family because of its lack of lactose-binding activity. The crystal structure has been solved.
18219197 CCL13 and HSPC159 mRNA expressions in PBMC are up-regulated specifically in MCNS patients during the nephrosis phase.
16682780 Galectin-related protein named GRP comprises only one conserved carbohydrate-recognition domain with 38 additional N-terminal residues. The crystals belong to the monoclinic space group C2.

AA Sequence

MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAIS      1 - 70
LTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVD     71 - 140
GHQLFDFYHRIQTLSAIDTIKINGDLQITKLG                                          141 - 172
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18433051 2008 Crystal structure of the putative carbohydrate recognition domain of human galectin-related protein.
18320588 2008 Crystal structure of the C-terminal conserved domain of human GRP, a galectin-related protein, reveals a function mode different from those of galectins.
18219197 2008 Gene expression profiling of peripheral blood mononuclear cells from patients with minimal change nephrotic syndrome by cDNA microarrays.
16682780 2006 Expression, purification, crystallization and preliminary X-ray characterization of the GRP carbohydrate-recognition domain from Homo sapiens.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.