Property Summary

Ligand Count 4
NCBI Gene PubMed Count 124
PubMed Score 196.69
PubTator Score 166.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Nephritis 51 0.0 0.0
Disease Target Count Z-score Confidence
Cancer 2499 3.393 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.100 4.2e-02
cutaneous lupus erythematosus 2.700 3.3e-05
glioblastoma 1.200 3.8e-03
interstitial cystitis 1.200 1.9e-03
osteosarcoma -1.256 5.8e-03
pancreatic cancer 1.100 4.6e-03
primary pancreatic ductal adenocarcinoma 1.045 1.1e-02
Rheumatoid arthritis -1.500 2.4e-02
subependymal giant cell astrocytoma 1.641 3.3e-03
tuberculosis 1.200 5.6e-05

Gene RIF (115)

AA Sequence

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGG      1 - 70
YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSV     71 - 140
QLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFST    141 - 210
PAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRN    211 - 280
TQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL    281 - 350
THVQT                                                                     351 - 355
//

Text Mined References (127)

PMID Year Title