Property Summary

Ligand Count 3
NCBI Gene PubMed Count 69
PubMed Score 130.41
PubTator Score 110.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.300 1.2e-03
astrocytic glioma -1.900 1.2e-02
atypical teratoid / rhabdoid tumor -1.700 8.2e-07
Breast cancer 1.100 1.1e-06
breast carcinoma 1.100 4.4e-22
cystic fibrosis -1.100 1.4e-04
ductal carcinoma in situ 1.200 1.4e-02
ependymoma -1.800 2.3e-02
group 4 medulloblastoma -1.100 9.0e-03
invasive ductal carcinoma 1.500 2.1e-03
juvenile dermatomyositis 1.157 5.6e-12
lung adenocarcinoma 1.079 2.2e-04
lung cancer 1.500 1.3e-03
medulloblastoma, large-cell -1.700 4.0e-05
non-small cell lung cancer 1.353 2.5e-10
oligodendroglioma -2.100 1.7e-02
osteosarcoma -1.367 1.1e-04
ovarian cancer -4.600 2.8e-12
Pick disease -1.200 2.6e-04
pituitary cancer -1.100 4.5e-05
primitive neuroectodermal tumor -1.200 3.5e-02
psoriasis 1.100 8.8e-09
Rheumatoid arthritis 1.400 1.4e-03
tuberculosis and treatment for 3 months -1.200 1.4e-03

PDB (28)

Gene RIF (48)

AA Sequence

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRF      1 - 70
KRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGI     71 - 140
YGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNAN    141 - 210
AKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKV    211 - 280
AVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW                                     281 - 317
//

Text Mined References (70)

PMID Year Title