Property Summary

NCBI Gene PubMed Count 13
PubMed Score 614.10
PubTator Score 10.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Influenza 142 5.728 2.9
Cancer 2499 4.127 2.1

Expression

Synonym

Accession P47929 Q6IB87 Gal-7
Symbols PI7
GAL7
Gal-7
HKL-14
LGALS7

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
OMA EggNOG

PDB (15)

Gene RIF (2)

AA Sequence

MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW      1 - 70
GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF         71 - 136
//

Text Mined References (13)

PMID Year Title