Property Summary

Ligand Count 3
NCBI Gene PubMed Count 35
PubMed Score 2005.93
PubTator Score 477.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Barrett's esophagus 5.000 2.0e-02
colon cancer -1.900 4.2e-03
esophageal adenocarcinoma 5.200 1.8e-02
interstitial cystitis -2.000 3.9e-02
intraductal papillary-mucinous adenoma (... 2.300 7.3e-03
intraductal papillary-mucinous carcinoma... 3.100 2.6e-03
intraductal papillary-mucinous neoplasm ... 2.600 1.7e-02
lung adenocarcinoma 1.300 2.4e-03
pancreatic cancer 2.000 2.9e-04
psoriasis -1.100 3.7e-14
urothelial carcinoma -2.800 1.5e-02

Synonym

Accession P56470 Gal-4
Symbols GAL4
L36LBP

Gene

PANTHER Protein Class (1)

PDB

1X50   4XZP   4YLZ   4YM0   4YM1   4YM2   4YM3   5CBL   5DUU   5DUV   5DUW   5DUX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Process (1)

Gene RIF (29)

AA Sequence

MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDG      1 - 70
WDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDG     71 - 140
DLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIII    141 - 210
KGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRC    211 - 280
GLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI                               281 - 323
//

Text Mined References (35)

PMID Year Title