Property Summary

NCBI Gene PubMed Count 51
PubMed Score 13.38
PubTator Score 63.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute myeloid leukemia 3.000 2.0e-03
Atopic dermatitis 1.100 4.5e-02
chronic lymphosyte leukemia -1.200 4.2e-06
colon cancer -3.200 7.8e-08
cutaneous lupus erythematosus 1.800 2.5e-02
gastric cancer -1.200 2.7e-03
glioblastoma -1.100 2.9e-05
head and neck cancer and chronic obstruc... 1.100 8.2e-03
interstitial cystitis 1.600 4.7e-02
intraductal papillary-mucinous adenoma (... -4.600 1.5e-04
intraductal papillary-mucinous carcinoma... -3.600 5.7e-03
intraductal papillary-mucinous neoplasm ... -3.600 8.6e-03
lung adenocarcinoma -1.200 2.5e-03
lung cancer -1.400 1.7e-03
nephrosclerosis -1.664 1.7e-02
osteosarcoma -2.756 3.1e-06
ovarian cancer -4.300 4.5e-21
pancreatic cancer -1.700 2.9e-03
pituitary cancer 1.400 7.0e-04
primary pancreatic ductal adenocarcinoma -2.966 2.8e-03
primary Sjogren syndrome 1.800 2.9e-03
psoriasis 1.100 1.9e-07
sarcoidosis 2.500 3.3e-02
tuberculosis 1.900 1.6e-04
ulcerative colitis -1.320 1.5e-02

Gene RIF (45)

AA Sequence

MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQR      1 - 70
EDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE             71 - 132
//

Text Mined References (52)

PMID Year Title