Property Summary

Ligand Count 3
NCBI Gene PubMed Count 344
PubMed Score 744.64
PubTator Score 1537.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia 2.000 3.9e-02
Breast cancer 1.400 3.6e-04
cystic fibrosis 1.500 3.5e-04
diabetes mellitus -1.500 3.4e-03
ependymoma 1.200 9.3e-05
fibroadenoma -1.200 2.2e-02
gastric carcinoma 1.700 9.8e-03
glioblastoma 2.100 6.0e-03
group 4 medulloblastoma -1.800 6.3e-04
intraductal papillary-mucinous adenoma (... -2.300 2.7e-04
intraductal papillary-mucinous carcinoma... -2.300 1.2e-02
lung carcinoma -1.400 8.1e-22
medulloblastoma, large-cell -1.100 2.6e-03
nasopharyngeal carcinoma 1.900 7.3e-06
non primary Sjogren syndrome sicca 1.100 1.9e-02
osteosarcoma 1.885 6.9e-04
ovarian cancer -2.600 8.6e-07
pancreatic cancer 1.200 4.0e-03
pituitary cancer -1.100 2.6e-03
primary pancreatic ductal adenocarcinoma 2.603 3.5e-04
subependymal giant cell astrocytoma 2.120 1.5e-02
ulcerative colitis 1.400 5.4e-03
Waldenstrons macroglobulinemia 1.353 3.1e-03

 GWAS Trait (1)

PDB (27)

Gene RIF (293)

AA Sequence

MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG      1 - 70
TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD          71 - 135
//

Text Mined References (356)

PMID Year Title