Property Summary

NCBI Gene PubMed Count 25
PubMed Score 1.43
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.100 5.5e-06
acute quadriplegic myopathy 1.492 4.5e-08
primary pancreatic ductal adenocarcinoma -1.052 8.7e-03
inflammatory breast cancer -1.500 6.3e-06
invasive ductal carcinoma -1.100 8.9e-04
ovarian cancer -1.600 2.8e-05
pancreatic cancer -1.200 6.0e-03

Gene RIF (18)

PMID Text
26470691 Demonstrate that HBx-HCCR-E-cadherin regulation pathway might play an important role in HBV-induced hepatocarcinogenesis.
25034723 These findings suggest that HCCR gene is over-expressed in acute leukemia patients and may be a useful biomarker for monitoring minimal residual disease.
24126909 HCCR2 gene plays an important role in the tumorigenesis of leukemia.
22851403 HCCRBP-3 induces tumorigenesis through direct interaction with HCCR-1 in human cancers.
22511601 The data demonstrate that HCCR-1 may be used as a novel predictor for the prognosis of the patients with esophageal squamous cell carcinoma.
21138632 The overexpression of HCCR-2 could enhance the division and proliferation of SMMC 7721 cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20591135 induces neoplastic cell transformation and epithelial-mesenchymal transdifferentiation
20423485 Treatment of PANC-1 cells with epidermal growth factor increased HCCR-1 protein level via PI3K/Akt/mTOR signaling.
20196787 HCCR-1 might play a role in the breast tumourigenesis while the overexpression of HCCR-1 induces the obesity probably by inhibiting the cholesterol-lowering effect of ApoE
19435525 TCF and beta-catenin binding plays important roles in HCCR-1 oncogene expression.
19208263 Data indicate that the level of HCCR-1 in breast cancer tissues is correlated with the HER2 overexpression, p53 mutation, and ER/PR status, and determination of HCCR-1 levels as options for HER2 testing is promising although it needs further evaluation.
18045496 These experiments show the biological features of HCCR-1 in the cell, and suggest that uncontrolled expression of HCCR-1 may cause mitochondrial dysfunction.
16949218 These results suggest that the HCCR-1 oncogene expression was regulated by the phosphatidylinositol 3-kinase/Akt signaling pathway.
16278390 HCCR oncoprotein has a role in development of human breast cancer
14691448 HCCR-2 represents an oncoprotein that is related to breast cancer development and regulation of the p53 tumor suppressor.
12879013 HCCR-2 probably represents a new oncogene that is related to tumorigenesis, functioning as a negative regulator of the p53 tumor suppressor
12061725 Human, similar to bacterial ribosomal protein L14 and yeast L22, gene L14.22 (clone 507E08), over-expressed in gliomas.

AA Sequence

MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGK      1 - 70
YHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQFRQDVTKCLF     71 - 140
LGIISIPPFANYLVFLLMYLFPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGL    141 - 210
RWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHT    211 - 280
TVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVL    281 - 350
LSTNYLGTRR                                                                351 - 360
//

Text Mined References (29)

PMID Year Title
26470691 2015 Up-regulation of human cervical cancer proto-oncogene contributes to hepatitis B virus-induced malignant transformation of hepatocyte by down-regulating E-cadherin.
25034723 2015 Quantitative detection of the human cervical cancer oncogene for monitoring the minimal residual disease in acute leukemia.
24126909 2013 Silencing HCCR2 expression inhibits the proliferation of leukemia cells by inducing apoptosis and promoting cell cycle arrest.
22851403 2014 HCCRBP-3 induces tumorigenesis through direct interaction with HCCR-1 in human cancers.
22511601 2012 Clinical implication of elevated human cervical cancer oncogene-1 expression in esophageal squamous cell carcinoma.
21138632 2010 [HCCR-2 enhances the division and proliferation of SMMC 7721 via PI3K/Akt pathway].
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20591135 2010 Transdifferentiation-inducing HCCR-1 oncogene.
20423485 2010 Epidermal growth factor induces HCCR expression via PI3K/Akt/mTOR signaling in PANC-1 pancreatic cancer cells.
20196787 2009 Dual action of apolipoprotein E-interacting HCCR-1 oncoprotein and its implication for breast cancer and obesity.
19435525 2009 TCF/beta-catenin plays an important role in HCCR-1 oncogene expression.
19208263 2009 Oncoprotein HCCR-1 expression in breast cancer is well correlated with known breast cancer prognostic factors including the HER2 overexpression, p53 mutation, and ER/PR status.
18045496 2007 HCCR-1, a novel oncogene, encodes a mitochondrial outer membrane protein and suppresses the UVC-induced apoptosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17943721 2008 HCCRBP-1 directly interacting with HCCR-1 induces tumorigenesis through P53 stabilization.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16949218 2006 The phosphatidylinositol 3-kinase/Akt pathway regulates the HCCR-1 oncogene expression.
16934181 2006 A novel full-length gene of human ribosomal protein L14.22 related to human glioma.
16762630 2006 HCCR-1-interacting molecule "deleted in polyposis 1" plays a tumor-suppressor role in colon carcinogenesis.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16278390 2005 The HCCR oncoprotein as a biomarker for human breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691448 2004 Transgenic mouse model for breast cancer: induction of breast cancer in novel oncogene HCCR-2 transgenic mice.
12879013 2003 Identification and differential expression of novel human cervical cancer oncogene HCCR-2 in human cancers and its involvement in p53 stabilization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12061725 2002 Isolation of novel differentially expressed genes related to human glioma using cDNA microarray and characterizations of two novel full-length genes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.