Property Summary

NCBI Gene PubMed Count 30
PubMed Score 37.80
PubTator Score 38.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -4.100 2.8e-06
osteosarcoma -3.086 4.9e-08
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02

Gene RIF (23)

PMID Text
26722481 LETM1 plays an important role in the progression of breast cancer
25617527 LETM1 protein overexpression is associated with Triple negative breast cancer progression, and may be a potential biomarker for poor prognostic evaluation of Triple negative breast cancer.
25077561 Reconstitution of LETM1 or antioxidant overexpression rescued mitochondrial Ca(2+) transport and bioenergetics
24898248 NCLX, but not LETM1, mediates Ca(2+) extrusion from mitochondria. By controlling the duration of matrix Ca(2+) elevations, NCLX contributes to the regulation of NAD(P)H production and to the conversion of Ca(2+) signals into redox changes.
24689060 LETM1 plays an important role in the progression of head and neck squamous cell carcinoma.
24626991 These findings identify novel cellular phenotypes in Wolf-Hirschhorn syndrome attributable to a 50% reduction in LETM1 expression level.
24344246 Functional properties of Letm1 described in study are remarkably similar to those of the H(+)-dependent Ca(2+) transport mechanism identified in intact mitochondria.
23963300 Haploinsufficiency of WHSC1 and/or LETM1 contributes to Wolf-Hirschhorn Syndrome, but that loss of distinct and/or additional genes in 4p16.3 is necessary for the expression of the core Wolf-Hirschhorn Syndrome phenotype.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of leucine zipper-EF-hand containing transmembrane protein 1 (LETM1) expression by HIV-1 Vpr in Vpr transduced macrophages
23716663 Data indicate that loss of Letm1 contributes to the pathology of Wolf-Hirschhorn syndrome and may contribute to seizure phenotypes by reducing glucose oxidation and other specific metabolic alterations.
23645710 Letm1 expression is decreased in patients with intractable TLE and a rat model of epilepsy. Down-regulation of Letm1 leads to increases mitochondrial swelling and decreased MT-CYB expression, which is associated with susceptibility to seizures.
22641639 Summarizes the current state of the art about the functions of LETM1 and its role in pathophysiology, with some emphasis on whether it is a feasible candidate for regulation of mitochondrial Ca2+ homeostasis.
21815251 we have identified a novel submicroscopic duplication involving dosage sensitive genes TACC3, FGFR3, and LETM1.
21613221 Letm1 and UCP2/3 independently contribute to two distinct, mitochondrial Ca(2+) uptake pathways in intact endothelial cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20824095 LETM1 suppressed lung cancer cell growth in vitro and in vivo.
19797662 Letm1, was found to specifically mediate coupled Ca2+/H+ exchange; RNAi knockdown, overexpression, and liposome reconstitution of the purified Letm1 protein demonstrate that Letm1 is a mitochondrial Ca2+/H+ antiporter
19318571 Data suggest that LETM1 serves as an anchor protein for complex formation with the mitochondrial ribosome and regulates mitochondrial biogenesis. Increased expression of LETM1 in human cancer suggests that dysregulation of LETM1 features in tumorigenesis.
19168126 LETM1 protein is a novel binding partner for Carboxyl-terminal modulator protein that may play an important role in mitochondrial fragmentation via optic atrophy type 1-cleavage.
18628306 the LETM1-mediated regulation of the mitochondrial volume and its interaction with the mitochondrial AAA-ATPase BCS1L that is responsible for three different human disorders
17925330 Study shows that human LETM1 is located in the inner membrane, exposed to the matrix and oligomerized in higher molecular weight complexes of unknown composition; down-regulation of LETM1 caused 'necrosis-like' death, without activation of caspases.
17606466 Here, we present cellular and biochemical analysis of Letm1
14706454 LETM1 is evolutionarily conserved throughout the eukaryotic kingdom and located in the mitochondria.

AA Sequence

MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIHPVYTSSRGDHL      1 - 70
GCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSLKDKNKKLEEGGPV     71 - 140
YSPPAEVVVKKSLGQRVLDELKHYYHGFRLLWIDTKIAARMLWRILNGHSLTRRERRQFLRICADLFRLV    141 - 210
PFLVFVVVPFMEFLLPVAVKLFPNMLPSTFETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKG    211 - 280
SATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTM    281 - 350
RLRSIKADDKLIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRA    351 - 420
MYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREKELQKRSE    421 - 490
VAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETLKDTAPVLEGLKEEEITKEEIDILSDACSKLQEQKK    491 - 560
SLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQ    561 - 630
QAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDV    631 - 700
HISTSQVAEIVATLEKEEKVEEKEKAKEKAEKEVAEVKS                                   701 - 739
//

Text Mined References (35)

PMID Year Title
26722481 2015 LETM1 overexpression is correlated with the clinical features and survival outcome of breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25617527 2015 Clinical implication of leucine zipper/EF hand-containing transmembrane-1 overexpression in the prognosis of triple-negative breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25077561 2014 LETM1-dependent mitochondrial Ca2+ flux modulates cellular bioenergetics and proliferation.
24898248 2014 NCLX protein, but not LETM1, mediates mitochondrial Ca2+ extrusion, thereby limiting Ca2+-induced NAD(P)H production and modulating matrix redox state.
24689060 2014 High expression of leucine zipper-EF-hand containing transmembrane protein 1 predicts poor prognosis in head and neck squamous cell carcinoma.
24626991 2014 LETM1 haploinsufficiency causes mitochondrial defects in cells from humans with Wolf-Hirschhorn syndrome: implications for dissecting the underlying pathomechanisms in this condition.
24344246 2014 Functional reconstitution of the mitochondrial Ca2+/H+ antiporter Letm1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23963300 2014 Deletions involving genes WHSC1 and LETM1 may be necessary, but are not sufficient to cause Wolf-Hirschhorn Syndrome.
23716663 2013 Letm1, the mitochondrial Ca2+/H+ antiporter, is essential for normal glucose metabolism and alters brain function in Wolf-Hirschhorn syndrome.
23645710 2014 Association of mitochondrial letm1 with epileptic seizures.
22641639 2012 Perspectives on: SGP symposium on mitochondrial physiology and medicine: the pathophysiology of LETM1.
21815251 2011 A novel 4p16.3 microduplication distal to WHSC1 and WHSC2 characterized by oligonucleotide array with new phenotypic features.
21613221 2011 Leucine zipper EF hand-containing transmembrane protein 1 (Letm1) and uncoupling proteins 2 and 3 (UCP2/3) contribute to two distinct mitochondrial Ca2+ uptake pathways.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20824095 2010 Suppression of lung tumorigenesis by leucine zipper/EF hand-containing transmembrane-1.
19797662 2009 Genome-wide RNAi screen identifies Letm1 as a mitochondrial Ca2+/H+ antiporter.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19318571 2009 Association of LETM1 and MRPL36 contributes to the regulation of mitochondrial ATP production and necrotic cell death.
19168126 2009 Regulation of OPA1-mediated mitochondrial fusion by leucine zipper/EF-hand-containing transmembrane protein-1 plays a role in apoptosis.
18628306 2008 Characterization of the mitochondrial protein LETM1, which maintains the mitochondrial tubular shapes and interacts with the AAA-ATPase BCS1L.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17925330 2008 LETM1, deleted in Wolf-Hirschhorn syndrome is required for normal mitochondrial morphology and cellular viability.
17606466 2007 Inverse correlation between expression of the Wolfs Hirschhorn candidate gene Letm1 and mitochondrial volume in C. elegans and in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15138253 2004 The LETM1/YOL027 gene family encodes a factor of the mitochondrial K+ homeostasis with a potential role in the Wolf-Hirschhorn syndrome.
14706454 2004 LETM1, a gene deleted in Wolf-Hirschhorn syndrome, encodes an evolutionarily conserved mitochondrial protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10486213 1999 LETM1, a novel gene encoding a putative EF-hand Ca(2+)-binding protein, flanks the Wolf-Hirschhorn syndrome (WHS) critical region and is deleted in most WHS patients.