Property Summary

NCBI Gene PubMed Count 12
PubMed Score 23.03
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -2.200 3.1e-07
psoriasis -1.500 1.3e-04
osteosarcoma -1.355 3.5e-03
glioblastoma 1.800 4.9e-04
atypical teratoid / rhabdoid tumor 1.600 9.9e-08
medulloblastoma, large-cell 1.700 1.4e-05
primitive neuroectodermal tumor 1.400 9.5e-05
juvenile dermatomyositis 1.078 5.9e-16
tuberculosis -1.800 1.1e-05
lung cancer -1.500 4.5e-04
pediatric high grade glioma 1.400 1.6e-08
group 3 medulloblastoma 1.100 3.9e-03
pilocytic astrocytoma 1.100 1.0e-06
posterior fossa group B ependymoma 1.200 1.3e-10
invasive ductal carcinoma 1.200 1.3e-02
ovarian cancer -2.700 2.3e-07
pituitary cancer 1.400 2.4e-07

Synonym

Accession O95214 E9PHP8 Q9BW48
Symbols Vps55
my047
HSPC112

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GWAS Trait (1)

Pathway (1)

Gene RIF (3)

PMID Text
20734064 Observational study of gene-disease association. (HuGE Navigator)
19907080 Transgenic mice expressing either human LEPROT or human LEPROTL1 displayed growth retardation, reduced plasma IGF1 levels, and impaired hepatic sensitivity to GH, as measured by STAT5 phosphorylation and Socs2 mRNA expression.
19876004 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELA      1 - 70
IFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW              71 - 131
//

Text Mined References (13)

PMID Year Title
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
19907080 2009 LEPROT and LEPROTL1 cooperatively decrease hepatic growth hormone action in mice.
19876004 2010 Obesity-related polymorphisms and their associations with the ability to regulate fat oxidation in obese Europeans: the NUGENOB study.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11342119 2001 Cloning and characterization of a novel human leptin receptor overlapping transcript-like 1 gene (LEPROTL1).
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.