Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.12
PubTator Score 6.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.196 1.2e-04
adult high grade glioma 1.100 1.7e-03
aldosterone-producing adenoma -1.147 1.7e-02
Astrocytoma, Pilocytic 1.200 7.3e-06
autosomal dominant Emery-Dreifuss muscul... 1.261 2.9e-03
Breast cancer -1.200 1.0e-10
breast carcinoma -1.100 6.2e-21
cystic fibrosis -1.096 3.9e-04
dermatomyositis 1.300 4.1e-03
Down syndrome 1.400 1.5e-03
glioblastoma 1.200 1.1e-04
group 3 medulloblastoma 1.300 9.7e-03
invasive ductal carcinoma -1.300 5.9e-03
juvenile dermatomyositis 1.172 9.4e-11
lung cancer -1.100 5.5e-04
Multiple myeloma 1.464 3.0e-03
non-small cell lung cancer -1.426 1.9e-18
osteosarcoma 1.458 1.2e-04
ovarian cancer -2.500 1.3e-08
subependymal giant cell astrocytoma 1.293 1.7e-02
ulcerative colitis -1.097 4.2e-02

 GO Function (1)

Gene RIF (5)

AA Sequence

MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELA      1 - 70
YFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW              71 - 131
//

Text Mined References (16)

PMID Year Title