Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MLLKEKEDSLMTCQQIYKALQEELTVKEKQEEDIKRRINLAENELEITKTLLNQTREEVLTLKNERELML      1 - 70
ISHQKSIEQLQETLRQKLLSDDNWKEKIEAELAKERAQHLVEFEEQALLFKEETKLQLDIEKEKHQDVIQ     71 - 140
KYKKEQEELQMKISDLITGATRDLRQEVTTLKEKLHKSHIRYTEESNSKEKEIENLKNLVAEFESRLKKE    141 - 210
IDSNDSVSENLRKEMEQKSDELKRVMLAQTQLIEQFNQSQEENTFLQETVRRECEERFELTEALSQAREQ    211 - 280
LLELSKLRGSLPFSPCSLSKGSLTSPAAAVSNHGERSLARLNSEKGIQIPNLRGVSKPTTFPTSDKPKRV    281 - 350
RSGVPILPQPHPPRGGASSANETRQRLAAILRRRRSQQ                                    351 - 388
//

Text Mined References (13)

PMID Year Title