Property Summary

NCBI Gene PubMed Count 25
PubMed Score 90.27
PubTator Score 35.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.500 1.0e-02
diabetes mellitus 1.600 1.1e-03
pediatric high grade glioma 1.300 2.6e-03
group 3 medulloblastoma 1.500 1.2e-02
posterior fossa group B ependymoma 1.300 4.5e-06
ovarian cancer -1.100 1.0e-02
psoriasis -1.700 1.4e-25

Protein-protein Interaction (3)

Gene RIF (10)

PMID Text
22469982 Lefty A may account for the tumor suppressive activity of human adult stem cells.
21401636 Findings show that during embryonic development, EBAF/LEFTY B plays important roles in decidualization and embryo implantation.
21266536 Findings suggest that Lefty2 is negatively modulated by miR-302s in hESCs, which plays an important role in maintaining the balance between pluripotency and germ layer specification.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
17038673 LEFTY proteins, which are known to play a major role during mouse gastrulation, are transiently expressed during human embryonic stem cell differentiation.
15536155 Addition of recombinant LEFTY-A to explants induced MMP-9 in most samples, a response prevented by ovarian steroids.
15308665 nodal and the inhibitors of Nodal signaling, lefty-A and lefty-B, are down-regulated very early upon differentiation of human embryonic stem cells
12215426 may provide a crucial signal for endometrial breakdown and bleeding by triggering expression of several matrix metalloproteinases
9230066 findings show that the TGFB4 (ebaf) mRNA has distinct tumor specific expression

AA Sequence

MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHG      1 - 70
DRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRS     71 - 140
AQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGP    141 - 210
LASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKN    211 - 280
WVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQK    281 - 350
CSCASDGALVPRRLQP                                                          351 - 366
//

Text Mined References (27)

PMID Year Title
27404958 2016 LeftyA decreases Actin Polymerization and Stiffness in Human Endometrial Cancer Cells.
25838200 2015 LeftyA sensitive cytosolic pH regulation and glycolytic flux in Ishikawa human endometrial cancer cells.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
22469982 2013 Role of Lefty in the anti tumor activity of human adult liver stem cells.
21401636 2011 Isolation, characterization, and function of EBAF/LEFTY B: role in infertility.
21266536 2011 The Nodal inhibitor Lefty is negatively modulated by the microRNA miR-302 in human embryonic stem cells.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
17038673 2007 Molecular analysis of LEFTY-expressing cells in early human embryoid bodies.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15536155 2005 Regulation of matrix metalloproteinase-9/gelatinase B expression and activation by ovarian steroids and LEFTY-A/endometrial bleeding-associated factor in the human endometrium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308665 2004 Expression of nodal, lefty-a, and lefty-B in undifferentiated human embryonic stem cells requires activation of Smad2/3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12215426 2002 Regulation and function of LEFTY-A/EBAF in the human endometrium. mRNA expression during the menstrual cycle, control by progesterone, and effect on matrix metalloprotineases.
11100524 Mutation analysis of human LEFTY A and LEFTY B genes in children with Ivemark syndrome.
10902804 2000 Dysregulated expression of ebaf, a novel molecular defect in the endometria of patients with infertility.
10886363 2000 Distinct transcriptional regulation and phylogenetic divergence of human LEFTY genes.
10053005 1999 Characterization and mutation analysis of human LEFTY A and LEFTY B, homologues of murine genes implicated in left-right axis development.
9665343 1998 Temporal and site-specific expression of transforming growth factor-beta4 in human endometrium.
9496783 1998 Stra3/lefty, a retinoic acid-inducible novel member of the transforming growth factor-beta superfamily.
9230066 1997 Distinct tumor specific expression of TGFB4 (ebaf)*, a novel human gene of the TGF-beta superfamily.
9153275 1997 Detection of ebaf, a novel human gene of the transforming growth factor beta superfamily association of gene expression with endometrial bleeding.
3457014 1986 Type beta transforming growth factor in human platelets: release during platelet degranulation and action on vascular smooth muscle cells.