Property Summary

NCBI Gene PubMed Count 166
PubMed Score 352.41
PubTator Score 279.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
chronic lymphocytic leukemia 4.039 3.0e-11
urothelial carcinoma 1.700 1.6e-02
malignant mesothelioma 3.800 4.1e-08
cutaneous lupus erythematosus 1.100 4.5e-02
psoriasis -1.200 1.1e-03
ependymoma 1.100 3.9e-03
atypical teratoid / rhabdoid tumor 1.100 4.5e-05
medulloblastoma, large-cell 1.600 3.8e-02
primary pancreatic ductal adenocarcinoma 2.078 5.2e-03
non-small cell lung cancer 1.492 5.2e-15
Common variable immunodeficiency -1.009 2.1e-02
intraductal papillary-mucinous neoplasm ... 1.400 4.6e-02
lung cancer 4.800 1.5e-06
colon cancer 3.500 1.7e-05
sarcoidosis -1.500 4.7e-05
pancreatic cancer 2.200 1.3e-04
breast carcinoma 1.700 1.2e-04
interstitial cystitis 1.100 6.6e-04
sonic hedgehog group medulloblastoma 1.800 8.4e-03
primary Sjogren syndrome 2.200 2.6e-04
invasive ductal carcinoma 2.002 2.7e-06
Pick disease 1.100 2.4e-02
gastric carcinoma 2.400 1.3e-02
ductal carcinoma in situ 2.200 3.6e-04
ulcerative colitis 1.800 4.8e-05
ovarian cancer -1.800 5.2e-03

Gene RIF (115)

PMID Text
27067790 The results suggest a role for beta-catenin/LEF1-mediated transcription in both malignant transformation and metastasis of prostate cancer
26580798 LEF-1 and MITF regulate tyrosinase gene transcription in vitro via binding to its promoter.
26339357 Methylprednisolone can suppress Wnt signaling pathway by down-regulating LEF-1 protein expression in chronic lymphocyte leukemia cells.
25955539 Overexpression of LEF1 is a favorable prognostic factor in childhood ALL.
25942645 high LEF1 expression and mutation are associated with high-risk leukemia and our results also revealed that LEF1 high expression and/or gain-of-function mutations are involved in leukemogenesis of ALL.
25808920 Authors found that the N-terminus of delta-catenin bound to the middle region of LEF-1 unlike beta-catenin. Overexpressed delta-catenin entered the nucleus and inhibited LEF-1-mediated transcriptional activity in Bosc23 and DLD-1 cell lines.
25646419 study identified TCF1 and LEF1 as Tax antagonistic factors in vivo, a fact which may critically influence the peripheral T-cell tropism of this virus
25639559 The results describe a novel mutation in LEF1 causing dysregulation of Wnt/B catenin signaling in eyelid sebaceous cancinoma
25596247 Proper sample processing ensured sufficient separation of positive LEF1 staining in T cells from negative staining in normal B and natural killer (NK) cells
25587085 Study found a negative correlation between miR-34a and LEF1 expression in prostate cancer cell lines and tumors and that miR-34a regulated epithelial-mesenchymal transition through direct binding to LEF1 mRNA 3' UTR region and silencing its translation.
25497834 LEF-1 expression in both basal cell adenomas and basal cell adenocarcinomas preferentially over other salivary gland tumors suggesting some utility as a diagnostic marker
25394300 LEF-1 expression is associated with the presence of KRAS mutations and may have prognostic value as a trend of worse overall survival is seen in patients with LEF-1-positive colorectal carcinoma.
25343173 Increased expression of beta-catenin, lymphoid enhancer-binding protein-1, and heparanase-1 is significantly correlated with decreased survival and poor prognosis in acral melanoma.
24897388 the expression of LEF1 is associated with the progression of human renal cell carcinoma and LEF1 maybe involved in the development of RCC
24858819 Elevated TCF-1 and LEF-1 expression is characteristic of malignant gliomas
24847765 Tcf1 and Lef1 cooperate with Runx factors to achieve stable silencing of the Cd4 gene in CD8(+) T cells.
24785257 miR26b may act as a potential therapeutic agent in reducing cancer cell proliferation through repressing LEF1 activation of c-Myc and cyclin D1 expression
24658583 These results further implicate the CTNNB1/LEF1 transcriptional complex in the development of solid-pseudopapillary neoplasms of the pancreas
24577083 Selenite caused CYLD upregulation via LEF1 and cIAP downregulation, both of which contribute to the degradation of ubiquitin chains on RIP1 and subsequent caspase-8 activation and colorectal tumor cell apoptosis.
24419084 By beta-catenin's association with LEF1 and BCL9-2/B9L.
24378360 LEF1 expression is an independent prognostic factor in APL, and could be used in patients risk stratification.
24098538 LEF1 protein was overexpressed in colon cancer tissues and knockdown of LEF1 expression inhibited colon cancer growth in vitro and in vivo.
24021930 Our study suggests LEF1 expression in oral squamous cell carcinoma may play an important role in tumor progression and can be served as a predictor of poor prognosis for patients with oral squamous cell carcinoma.
23913826 High LEF1 expression is associated with prostate cancer.
23713453 Results indicate that lymphoid enhancer-binding factor 1 (LEF1) contributes to the pathophysiology of acute myeloid leukemia (AML) and could be a predictor of better treatment response.
23572277 Studied the expression of TCF/LEF and SFRP family members (SFRP1 and SFRP3) to gain a better understanding of biological signaling pathways responsible for epidemiology and clinical parameters of clear cell RCC (cRCC).
23375451 This study supports a functionally important role for LEF1 and its target genes in Burkitt's lymphoma.
23325550 DNA-dependent protein kinase catalytic subunit is a novel interaction partner of lymphocyte enhancer factor 1.
23224985 Nuclear LEF1 correlate with cerebral metastasis of lung adenocarcinomas.
23068607 Results suggest that NDRG2 and prenylated Rab acceptor-1 (PRA1) might act synergistically to prevent signaling of T-cell facto/beta-catenin.
23001182 interaction of HCLS1 with LEF-1 is essential for G-CSF-triggered myeloid differentiation
22905168 n-Butyl benzyl phthalate promotes breast cancer progression by inducing expression of lymphoid enhancer factor 1
22815426 High LEF1 expression is associated with significantly better relapse-free survival, overall survival, and event-free survival of cytogenetically normal acute myeloid leukemia patients.
22792274 Lef1 is overexpressed in human endometrial tumors, consistent with it playing a role in gland proliferation.
22769578 this study demonstrated that miR-449a directly targets LEF-1, which in turn affects the expression of Sox 9, ultimately leading to the proper regulation of the differentiation and chondrogenesis
22766851 miR-218 is involved in the invasive behavior of glioblastoma cells by targeting LEF1 and blocking the invasive axis.
22686279 our results indicate a pivotal role of LEF-1 in the regulation of proliferation and MMP-7 transcription in breast cancer cells.
22639890 LEF-1 might play an important role in colon carcinogenesis by acting as a regulator.
22507326 results suggest that assessing intracellular beta-catenin and LEF1 expression might help in patient risk stratification and outcome prediction
22436613 findings suggest that transcriptional activation of LEF1 is a mechanism of cross talk between HGF/c-Met and Wnt/beta-catenin pathways and is essential for HGF-induced tumor invasion
22359570 a robust transcriptional CTNNAL1 up-regulation occurs during acute ozone-induced stress and is mediated at least in part by ozone-induced recruitments of LEF-1 and AP-2alpha to the human CTNNAL1 promoter.
22261717 nuclear IGF1R associates with the transcription factor LEF1 and increases promoter activity of LEF1 downstream target genes cyclin D1 and axin2.
22111711 In this review we present mounting evidence for the interdependency of TCF7/LEF1 variant expression and functions with cell lineage and cell state. [Review]
22020335 The study demonstrated a novel b-catenin/ LEF1-miR-372&373-Dickkopf-1 regulatory feedback loop, which may have a critical role in regulating the activity of Wnt/b-catenin signaling in human cancer cells.
21998751 differentiation status of chronic lymphocytic leukemia (CLL) cells would result in loss of LEF-1 expression
21980470 identification of a variable number of tandem repeats polymorphism in IDO1 promoter and characterization of LEF-1 response elements
21781440 An association between the maternal genotype and the occurrence of cleft lip or palate was observed at two polymorphic loci (rs10022956 and rs10025431), while a foetal-maternal effect modulating the risk of clefting was found at locus rs10025431.
21744004 HIV-1 Tat and methamphetamine suppresses expression of LEF-1, a key partner of beta-catenin to regulate cognate gene expression
21685909 Report universal nuclear overexpression of LEF1 but lack of nuclear beta-catenin in the majority of chronic lymphocytic leukemia/small lymphocytic lymphomas.
21599871 Melanoma cell phenotype switching behaviour is regulated by differential LEF1/TCF4 activity.
21544627 A strong promoter activity of pre-B cell stage-specific Crlz1 gene is caused by one distal LEF-1 and multiple proximal Ets sites.
21527502 lymphoid enhancer-binding factor 1 identifies androgen-independent epithelium in the developing prostate
21471213 a novel interaction between the VDR and LEF1 that is mediated by the DNA-binding domain of the VDR and that is required for normal canonical Wnt signaling in keratinocytes.
21444716 Alternative splicing of LEF1 exon 6 is regulated during pre-TCR signaling in thymic development and in response to activation of the JSL1 T-cell line and this is driven by the activity of CELF2.
21383983 Overexpression of LEF1 in primary colorectal carcinoma is a prognostic factor for poor survival and increased risk for liver metastasis.
21285352 HIPK2-dependent phosphorylation caused the dissociation of LEF1, TCF4, and TCF3 from a target promoter in vivo.
21270130 Lef1DeltaN binds beta-catenin, stimulates Lef/Tcf reporter activity, and promotes terminal osteoblast differentiation.
21190562 PC3 tumors are sustained by a small number of tumor-initiating cells with stem-like characteristics, including strong self-renewal and pro-angiogenic capability and marked by the expression pattern FAM65Bhigh/MFI2low/LEF1low.
20676368 LRP6-ICD interacts with AES exclusively in the nucleus and represses AES mediated TCF/LEF-1 reporter transcription.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20595513 This study identified aberrant protein expression of LEF-1 specifically in chronic lymphocytic leukemia but not in normal mature B-cell subsets or after B-cell activation.
20363964 LEF-1 binds specifically to the major histocompatibility complex class I-like protein CD1D promoter; enhanced expression of LEF1 in K562 or Jurkat cells suppresses CD1D promoter activity and downregulates endogenous CD1D transcripts.
20332099 Observational study of gene-disease association. (HuGE Navigator)
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20124220 LEF1 inactivation is an important step in the molecular pathogenesis of T-ALL in a subset of young children.
20098615 Observational study of gene-disease association. (HuGE Navigator)
20019092 EWS/FLI1 binds LEF1, interfering with the formation of beta-catenin-LEF1 complexes, and thus with their transcriptional activity.
19784072 Data show that elevated Snail expression by Pdcd4 knockdown leads to downregulation of E-cadherin resulting in activating beta-catenin/Tcf-dependent transcription.
19653274 expression of alternatively spliced Lef-1 isoforms is involved in the determination of proliferative or migratory characteristics of pancreatic carcinoma cells.
19590514 Observational study of gene-disease association. (HuGE Navigator)
19576624 Two WNT target genes, LEF1 and HOXB9, are identified as promoters of lung adenocarcinoma metastasis and mediators of chemotactic invasion and colony outgrowth.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19402906 hepatitis B surface antigen could stimulate proliferation and functional modification of hepatocytes via LEF-1 through the Wnt pathway at the pre-malignant stage
19351848 LEF1 is a potential marker for androgen-independent disease and a key regulator of AR expression and prostate cancer growth and invasion. LEF1 is highly expressed in androgen-independent prostate cancer.
19244345 By reducing COX-2 expression, caveolin-1 interrupts a feedback amplification loop involving PGE(2)-induced signaling events linked to beta-catenin/Tcf/Lef-dependent transcription of tumor survival genes including cox-2 itself and survivin.
19131506 GnRH regulation of Jun transcription requires a functional interaction between TCF/LEF and beta-catenin.
19079342 Id-1 is a novel PTEN inhibitor that could activate the Akt pathway and its downstream effectors, the Wnt/TCF pathway and p27(Kip1) phosphorylation
18936100 Dpr1 negatively modulates the basal activity of Wnt1/beta-catenin signaling in the nucleus by keeping LEF1 in the repressive state.
18615589 beta-catenin acts together with Lef-1 to influence DeltaNp63 promoter activity and protein expression
18579517 IL-4 stimulation possesses a negative effect on the expressions of LEF-1 and TCF-1 in primary T cells, suggesting a positive feedback effect of IL-4 on IL4 gene expression.
18316418 role of Lef-1 in the biology of acute leukemia, pointing to the necessity of balanced Lef-1 expression for an ordered hematopoietic development
17947518 Marked upregulation of lymphoid enhancer-binding factor 1 (LEF-1), a transcription factor in the Wnt pathway, was found in HBsAg-expressing cells
17785445 These data support a role for PITX2 in cell proliferation, migration, and cell division through differential Lef-1 isoform expression and interactions with Lef-1 and beta-catenin.
17785436 Re-expression of E-cadherin in HT29(US) cells restored the ability of caveolin-1 to down-regulate beta-catenin-Tcf/Lef-dependent transcription and survivin expression, as seen in HT29(ATCC) cells.
17585052 Notch1 co-opts Lef1 during the process of transformation to maintain survival of T-cell lymphomas
17466981 This study demonstrates that the two consensus Lef/Tcf binding elements (TBE)reported in neoplastic cells are dispensable for c-Myc regulation in normal keratinocytes, which instead use a novel TBE sequence variant.
17360796 LEF-1 is a decisive transcription factor in neutrophil granulopoiesis [review]
17240357 Additional prolactin (PRL) regulatory elements corresponding to LEF-l and AP-1 transcription factor binding sites appear important for PRL expression.
17132729 Cooperates with SMAD4 to activate c-myc expression.
17063141 LEF-1 is an instructive factor regulating neutrophilic granulopoiesis whose absence plays a critical role in the defective maturation program of myeloid progenitors in individuals with congenital neutropenia
16809766 the biological outcome of aberrant LEF1 activation in colon cancer is directed by differential promoter activation and repression
16714285 NARF functions as a novel ubiquitin-ligase to regulate ubiquitylation and degradation of T cell factor/lymphoid enhancer factor
16565724 Sebaceous gland neoplasms harbor inactivating mutations in LEF1.
16474850 hAR is a direct target of LEF-1/TCF transcriptional regulation in PCa cells; expression of the hAR protein is suppressed by a degradation pathway regulated by cross-talk of Wnt, Akt, and PP2A
16424171 Involvement of LEF1 protein in the wingless type protein (WNT) signaling pathway not only regulates T cell development, but also peripheral T cell differentiation.
16415175 Observational study of gene-disease association. (HuGE Navigator)
16142310 LEF1, a downstream component of the Wnt signaling pathway, mediates breast cancer cell invasion, and may be regulated in part by estradiol
16120831 LEF1 5'-untranslated region (UTR) mediates cap-independent translation; the 5'-UTR of full-length LEF1 mRNA contains a bona fide internal ribosome entry site (IRES).
15756419 Taken together, these data suggest that LEF-1 is abundantly expressed in human tumors and the ratio of the oncogenic and the dominant negative short isoform altered not only in carcinomas but also in leukemia.
15750622 Smad-binding peptide aptamer LEF1 can be developed to selectively inhibit TGF-beta-induced gene expression.
15728254 LEF-1 expression is regulated through PITX2, LEF-1 and beta-catenin direct physical interactions
15245424 a 110 bp Wnt/beta-catenin-responsive element, contained within a minimal 2.5 kb Lef-1 promoter, plays an important role in regulating mesenchymal, and potentially epithelial, expression during follicle development in mouse embryos.
15194563 Wnt regulation of the Lef-1 promoter at the WRE may play an important role during airway submucosal glandular bud formation.
15000148 Lymphoid enhancer factor/T cell factor has a role in development of colorectal cancer [review]
14990565 Beta-catenin, Lef-1, Ets transcription factors, and the AP-1 protein c-Jun each weakly enhanced luciferase expression from an OPN promoter.
12707037 loss of expression of this transcription factor in a subset of peripheral t-cell lymphomas
12589056 Tcf/LEF1 has a role in transcriptional induction of cyclin D1
12556497 These results suggest that NLK phosphorylation on these sites contributes to the down-regulation of LEF-1/TCF transcriptional activity.
12235165 induction of Lef/Tcf-dependent transcription in human endothelial cells by fibroblast growth factor-2
12183361 Nr-CAM is the gene most extensively induced by LEF1
12161443 ZEB1 plays a role in repressing E-cadherin and MUC1 in epithelial cells [ZEB-1]
12095232 direct evidence for a role of beta-catenin/LEF-1 signaling pathway in induction of epithelial-mesenchymal transformation
12052822 wnt3a-beta catenin signaling regulates LEF-1 gene expression
12048204 MITF-M transactivates its own promoter (M promoter) by interacting with LEF-1
12032083 Microphthalmia-associated transcription factor interacts with LEF-1, a mediator of Wnt signaling.

AA Sequence

MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGH      1 - 70
EVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSN     71 - 140
KVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPP    141 - 210
LGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLM    211 - 280
HVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYE    281 - 350
LARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI                         351 - 399
//

Text Mined References (170)

PMID Year Title
27067790 2016 Expression and colocalization of ?-catenin and lymphoid enhancing factor-1 in prostate cancer progression.
26580798 2015 LEF-1 Regulates Tyrosinase Gene Transcription In Vitro.
26339357 2015 Methylprednisolone suppresses the Wnt signaling pathway in chronic lymphocytic leukemia cell line MEC-1 regulated by LEF-1 expression.
25955539 2015 Overexpression of lymphoid enhancer-binding factor-1 (LEF1) is a novel favorable prognostic factor in childhood acute lymphoblastic leukemia.
25942645 2015 Characterization of LEF1 High Expression and Novel Mutations in Adult Acute Lymphoblastic Leukemia.
25808920 2015 ?-Catenin interacts with LEF-1 and negatively regulates its transcriptional activity.
25646419 2015 TCF1 and LEF1 act as T-cell intrinsic HTLV-1 antagonists by targeting Tax.
25639559 2015 Eyelid sebaceous carcinoma: a novel mutation in lymphoid enhancer-binding factor-1.
25596247 2015 Flow cytometric analysis of lymphoid enhancer-binding factor 1 in diagnosis of chronic lymphocytic leukemia/small lymphocytic lymphoma.
25587085 2015 LEF1 Targeting EMT in Prostate Cancer Invasion Is Regulated by miR-34a.
25497834 2015 A comparative analysis of LEF-1 in odontogenic and salivary tumors.
25394300 LEF-1 is frequently expressed in colorectal carcinoma and not in other gastrointestinal tract adenocarcinomas: an immunohistochemical survey of 602 gastrointestinal tract neoplasms.
25343173 2015 Increased levels of ?-catenin, LEF-1, and HPA-1 correlate with poor prognosis for acral melanoma with negative BRAF and NRAS mutation in BRAF exons 11 and 15 and NRAS exons 1 and 2.
24897388 2014 Expression and proliferation-promoting role of lymphoid enhancer-binding factor 1 in human clear cell renal carcinoma.
24858819 2014 Wnt signaling transcription factors TCF-1 and LEF-1 are upregulated in malignant astrocytic brain tumors.
24847765 2014 From inception to output, Tcf1 and Lef1 safeguard development of T cells and innate immune cells.
24785257 2014 MicroRNA-26b represses colon cancer cell proliferation by inhibiting lymphoid enhancer factor 1 expression.
24658583 2014 Overexpression of lymphoid enhancer-binding factor 1 (LEF1) in solid-pseudopapillary neoplasms of the pancreas.
24577083 2014 The LEF1/CYLD axis and cIAPs regulate RIP1 deubiquitination and trigger apoptosis in selenite-treated colorectal cancer cells.
24419084 2014 LEF1 and B9L shield ?-catenin from inactivation by Axin, desensitizing colorectal cancer cells to tankyrase inhibitors.
24378360 2014 Lymphoid enhancer binding factor-1 (LEF1) expression as a prognostic factor in adult acute promyelocytic leukemia.
24098538 2013 Knockdown of lymphoid enhancer factor 1 inhibits colon cancer progression in vitro and in vivo.
24021930 2014 Expression of LEF1 is an independent prognostic factor for patients with oral squamous cell carcinoma.
23913826 2013 ERG is a critical regulator of Wnt/LEF1 signaling in prostate cancer.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23713453 2014 Clinical significance of lymphoid enhancer-binding factor 1 expression in acute myeloid leukemia.
23572277 2013 Expression of secreted frizzled-related protein 1 and 3, T-cell factor 1 and lymphoid enhancer factor 1 in clear cell renal cell carcinoma.
23375451 2013 Aberrant lymphocyte enhancer-binding factor 1 expression is characteristic for sporadic Burkitt's lymphoma.
23325550 2013 Identification of DNA-dependent protein kinase catalytic subunit as a novel interaction partner of lymphocyte enhancer factor 1.
23224985 2013 Nuclear LEF1/TCF4 correlate with poor prognosis but not with nuclear ?-catenin in cerebral metastasis of lung adenocarcinomas.
23068607 2012 NDRG2 and PRA1 interact and synergistically inhibit T-cell factor/?-catenin signaling.
23001182 2012 Interactions among HCLS1, HAX1 and LEF-1 proteins are essential for G-CSF-triggered granulopoiesis.
22905168 2012 n-Butyl benzyl phthalate promotes breast cancer progression by inducing expression of lymphoid enhancer factor 1.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22815426 2012 High expression of lymphoid enhancer-binding factor-1 (LEF1) is a novel favorable prognostic factor in cytogenetically normal acute myeloid leukemia.
22792274 2012 The role of LEF1 in endometrial gland formation and carcinogenesis.
22769578 2012 miR-449a regulates the chondrogenesis of human mesenchymal stem cells through direct targeting of lymphoid enhancer-binding factor-1.
22766851 2012 MiR-218 reverses high invasiveness of glioblastoma cells by targeting the oncogenic transcription factor LEF1.
22686279 2012 LEF-1 regulates proliferation and MMP-7 transcription in breast cancer cells.
22639890 2012 The balance between two isoforms of LEF-1 regulates colon carcinoma growth.
22507326 Aberrant beta-catenin and LEF1 expression may predict the clinical outcome for patients with oropharyngeal cancer.
22436613 2012 Hepatocyte growth factor activates Wnt pathway by transcriptional activation of LEF1 to facilitate tumor invasion.
22359570 2012 Identification of transcription factors regulating CTNNAL1 expression in human bronchial epithelial cells.
22291604 2012 A genome-wide association study identified AFF1 as a susceptibility locus for systemic lupus eyrthematosus in Japanese.
22261717 2012 Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF.
22111711 2011 Cell-context dependent TCF/LEF expression and function: alternative tales of repression, de-repression and activation potentials.
22020335 2012 ?-Catenin/LEF1 transactivates the microRNA-371-373 cluster that modulates the Wnt/?-catenin-signaling pathway.
21998751 2011 Differentiation of chronic lymphocytic leukemia B cells into immunoglobulin secreting cells decreases LEF-1 expression.
21980470 2011 Identification of a variable number of tandem repeats polymorphism and characterization of LEF-1 response elements in the promoter of the IDO1 gene.
21781440 Evidence of LEF1 fetal-maternal interaction in cleft lip with or without cleft palate in a consistent Italian sample study.
21743491 2012 Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/?-catenin signaling axis.
21685909 2011 Nuclear overexpression of lymphoid-enhancer-binding factor 1 identifies chronic lymphocytic leukemia/small lymphocytic lymphoma in small B-cell lymphomas.
21599871 2011 Differential LEF1 and TCF4 expression is involved in melanoma cell phenotype switching.
21544627 2011 A strong promoter activity of pre-B cell stage-specific Crlz1 gene is caused by one distal LEF-1 and multiple proximal Ets sites.
21527502 2011 LEF1 identifies androgen-independent epithelium in the developing prostate.
21471213 2011 Lymphoid enhancer-binding factor-1 (LEF1) interacts with the DNA-binding domain of the vitamin D receptor.
21444716 2011 Signal- and development-dependent alternative splicing of LEF1 in T cells is controlled by CELF2.
21383983 2011 Comparative profiling of primary colorectal carcinomas and liver metastases identifies LEF1 as a prognostic biomarker.
21285352 2011 Phosphorylation of TCF proteins by homeodomain-interacting protein kinase 2.
21270130 2011 Lef1DeltaN binds beta-catenin and increases osteoblast activity and trabecular bone mass.
21190562 2010 PC3 prostate tumor-initiating cells with molecular profile FAM65Bhigh/MFI2low/LEF1low increase tumor angiogenesis.
20676368 2010 Differential modulation of TCF/LEF-1 activity by the soluble LRP6-ICD.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20595513 2010 LEF-1 is a prosurvival factor in chronic lymphocytic leukemia and is expressed in the preleukemic state of monoclonal B-cell lymphocytosis.
20363964 2010 Human CD1D gene expression is regulated by LEF-1 through distal promoter regulatory elements.
20360943 2010 Small molecule inhibitors of Wnt/beta-catenin/lef-1 signaling induces apoptosis in chronic lymphocytic leukemia cells in vitro and in vivo.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20219685 2010 Pathway-based approaches to imaging genetics association studies: Wnt signaling, GSK3beta substrates and major depression.
20128911 2010 SLUG: a new target of lymphoid enhancer factor-1 in human osteoblasts.
20124220 2010 Inactivation of LEF1 in T-cell acute lymphoblastic leukemia.
20123964 2010 Lipid phosphate phosphatase 3 stabilization of beta-catenin induces endothelial cell migration and formation of branching point structures.
20098615 2010 Application of gene network analysis techniques identifies AXIN1/PDIA2 and endoglin haplotypes associated with bicuspid aortic valve.
20019092 2010 The EWS/FLI1 oncogenic protein inhibits expression of the Wnt inhibitor DICKKOPF-1 gene and antagonizes beta-catenin/TCF-mediated transcription.
20018240 2010 Type I collagen promotes epithelial-mesenchymal transition through ILK-dependent activation of NF-kappaB and LEF-1.
19784072 2010 Downregulation of E-cadherin is an essential event in activating beta-catenin/Tcf-dependent transcription and expression of its target genes in Pdcd4 knockdown cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19653274 2010 Lef-1 isoforms regulate different target genes and reduce cellular adhesion.
19620402 2009 Neutrophil elastase is severely down-regulated in severe congenital neutropenia independent of ELA2 or HAX1 mutations but dependent on LEF-1.
19590514 2009 FGFR2 is associated with hair thickness in Asian populations.
19576624 2009 WNT/TCF signaling through LEF1 and HOXB9 mediates lung adenocarcinoma metastasis.
19460168 2009 Groucho binds two conserved regions of LEF-1 for HDAC-dependent repression.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19402906 2009 Role of hepatitis B surface antigen in the development of hepatocellular carcinoma: regulation of lymphoid enhancer-binding factor 1.
19351848 2009 LEF1 in androgen-independent prostate cancer: regulation of androgen receptor expression, prostate cancer growth, and invasion.
19244345 2009 Caveolin-1-mediated suppression of cyclooxygenase-2 via a beta-catenin-Tcf/Lef-dependent transcriptional mechanism reduced prostaglandin E2 production and survivin expression.
19131506 2009 GnRH-regulated expression of Jun and JUN target genes in gonadotropes requires a functional interaction between TCF/LEF family members and beta-catenin.
19079342 2009 Id-1 activates Akt-mediated Wnt signaling and p27(Kip1) phosphorylation through PTEN inhibition.
19060910 2009 Genome-wide association analysis of metabolic traits in a birth cohort from a founder population.
18936100 2008 Dapper1 is a nucleocytoplasmic shuttling protein that negatively modulates Wnt signaling in the nucleus.
18794125 2008 Nkx3-1 and LEF-1 function as transcriptional inhibitors of estrogen receptor activity.
18615589 2008 Glycogen synthase kinase-3beta regulates DeltaNp63 gene transcription through the beta-catenin signaling pathway.
18579517 2008 LEF-1 negatively controls interleukin-4 expression through a proximal promoter regulatory element.
18445004 2008 Lymphoid enhancer factor interacts with GATA-3 and controls its function in T helper type 2 cells.
18316418 2008 A novel role for Lef-1, a central transcription mediator of Wnt signaling, in leukemogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17947518 2007 Gene-expression profiles of a hepatitis B small surface antigen-secreting cell line reveal upregulation of lymphoid enhancer-binding factor 1.
17785445 2007 PITX2 and beta-catenin interactions regulate Lef-1 isoform expression.
17785436 2007 E-cadherin is required for caveolin-1-mediated down-regulation of the inhibitor of apoptosis protein survivin via reduced beta-catenin-Tcf/Lef-dependent transcription.
17585052 2007 Notch1 co-opts lymphoid enhancer factor 1 for survival of murine T-cell lymphomas.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
17466981 2007 Keratinocyte transcriptional regulation of the human c-Myc promoter occurs via a novel Lef/Tcf binding element distinct from neoplastic cells.
17360796 2007 LEF-1 is a decisive transcription factor in neutrophil granulopoiesis.
17240357 2007 Prolactin expression is induced in Jurkat T-cells by beta-catenin LEF-1, AP-1 and cAMP.
17132729 2006 Smad4 cooperates with lymphoid enhancer-binding factor 1/T cell-specific factor to increase c-myc expression in the absence of TGF-beta signaling.
17063141 2006 LEF-1 is crucial for neutrophil granulocytopoiesis and its expression is severely reduced in congenital neutropenia.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16809766 2006 Wnt activation and alternative promoter repression of LEF1 in colon cancer.
16714285 2006 NARF, an nemo-like kinase (NLK)-associated ring finger protein regulates the ubiquitylation and degradation of T cell factor/lymphoid enhancer factor (TCF/LEF).
16565724 2006 Human sebaceous tumors harbor inactivating mutations in LEF1.
16474850 2006 Complex regulation of human androgen receptor expression by Wnt signaling in prostate cancer cells.
16424171 2006 Human naive CD8 T cells down-regulate expression of the WNT pathway transcription factors lymphoid enhancer binding factor 1 and transcription factor 7 (T cell factor-1) following antigen encounter in vitro and in vivo.
16415175 2006 High throughput SNP and expression analyses of candidate genes for non-syndromic oral clefts.
16344550 2006 Differential use of functional domains by coiled-coil coactivator in its synergistic coactivator function with beta-catenin or GRIP1.
16142310 2005 Wnt pathway component LEF1 mediates tumor cell invasion and is expressed in human and murine breast cancers lacking ErbB2 (her-2/neu) overexpression.
16120831 2005 An internal ribosome entry site mediates translation of lymphoid enhancer factor-1.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15756419 2005 Alterations of lymphoid enhancer factor-1 isoform expression in solid tumors and acute leukemias.
15750622 2005 Selective inhibition of TGF-beta responsive genes by Smad-interacting peptide aptamers from FoxH1, Lef1 and CBP.
15728254 2005 PITX2, beta-catenin and LEF-1 interact to synergistically regulate the LEF-1 promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15245424 2004 Characterization of Lef-1 promoter segments that facilitate inductive developmental expression in skin.
15194563 2004 Wnt-responsive element controls Lef-1 promoter expression during submucosal gland morphogenesis.
15143193 2004 Cdx1 autoregulation is governed by a novel Cdx1-LEF1 transcription complex.
15000148 Lymphoid enhancer factor/T cell factor expression in colorectal cancer.
14990565 2004 Ets gene PEA3 cooperates with beta-catenin-Lef-1 and c-Jun in regulation of osteopontin transcription.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661054 2004 Plakoglobin (gamma-catenin) has TCF/LEF family-dependent transcriptional activity in beta-catenin-deficient cell line.
12901858 2003 Nemo-like kinase induces apoptosis in DLD-1 human colon cancer cells.
12748295 2003 A functional screen in human cells identifies UBF2 as an RNA polymerase II transcription factor that enhances the beta-catenin signaling pathway.
12707037 2003 Loss of expression of the WNT/beta-catenin-signaling pathway transcription factors lymphoid enhancer factor-1 (LEF-1) and T cell factor-1 (TCF-1) in a subset of peripheral T cell lymphomas.
12589056 2003 IKKalpha regulates mitogenic signaling through transcriptional induction of cyclin D1 via Tcf.
12556497 2003 Regulation of lymphoid enhancer factor 1/T-cell factor by mitogen-activated protein kinase-related Nemo-like kinase-dependent phosphorylation in Wnt/beta-catenin signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446687 2003 Identification of a promoter-specific transcriptional activation domain at the C terminus of the Wnt effector protein T-cell factor 4.
12408825 2002 ICAT inhibits beta-catenin binding to Tcf/Lef-family transcription factors and the general coactivator p300 using independent structural modules.
12235165 2002 Fibroblast growth factor-2 induces Lef/Tcf-dependent transcription in human endothelial cells.
12192039 2002 I-mfa domain proteins interact with Axin and affect its regulation of the Wnt and c-Jun N-terminal kinase signaling pathways.
12183361 2002 Nr-CAM is a target gene of the beta-catenin/LEF-1 pathway in melanoma and colon cancer and its expression enhances motility and confers tumorigenesis.
12161443 2002 Snail induction of epithelial to mesenchymal transition in tumor cells is accompanied by MUC1 repression and ZEB1 expression.
12095232 2002 Direct evidence for a role of beta-catenin/LEF-1 signaling pathway in induction of EMT.
12052822 2002 Wnt-3A/beta-catenin signaling induces transcription from the LEF-1 promoter.
12048204 2002 Melanocyte-specific microphthalmia-associated transcription factor isoform activates its own gene promoter through physical interaction with lymphoid-enhancing factor 1.
12032083 2002 Microphthalmia-associated transcription factor interacts with LEF-1, a mediator of Wnt signaling.
11751639 2001 Chromatin-specific regulation of LEF-1-beta-catenin transcription activation and inhibition in vitro.
11731474 2001 PIASy, a nuclear matrix-associated SUMO E3 ligase, represses LEF1 activity by sequestration into nuclear bodies.
11696550 2002 Alx4 binding to LEF-1 regulates N-CAM promoter activity.
11604490 2001 The notch intracellular domain can function as a coactivator for LEF-1.
11440173 2001 A novel isoform of human lymphoid enhancer-binding factor-1 (LEF-1) gene transcript encodes a protein devoid of HMG domain and nuclear localization signal.
11326276 2001 Beta-catenin-sensitive isoforms of lymphoid enhancer factor-1 are selectively expressed in colon cancer.
11266540 2001 All Tcf HMG box transcription factors interact with Groucho-related co-repressors.
10890911 2000 Association of Smads with lymphoid enhancer binding factor 1/T cell-specific factor mediates cooperative signaling by the transforming growth factor-beta and wnt pathways.
10825188 2000 Differential mechanisms of LEF/TCF family-dependent transcriptional activation by beta-catenin and plakoglobin.
10756202 2000 The human LEF-1 gene contains a promoter preferentially active in lymphocytes and encodes multiple isoforms derived from alternative splicing.
10644691 2000 Protein phosphatase 2Calpha dephosphorylates axin and activates LEF-1-dependent transcription.
9751710 1998 Transcriptional repression by AML1 and LEF-1 is mediated by the TLE/Groucho corepressors.
9671491 1998 Differential importin-alpha recognition and nuclear transport by nuclear localization signals within the high-mobility-group DNA binding domains of lymphoid enhancer factor 1 and T-cell factor 1.
9488439 1998 Two members of the Tcf family implicated in Wnt/beta-catenin signaling during embryogenesis in the mouse.
9119228 1997 ALY, a context-dependent coactivator of LEF-1 and AML-1, is required for TCRalpha enhancer function.
9119227 1997 An HMG I/Y-containing repressor complex and supercoiled DNA topology are critical for long-range enhancer-dependent transcription in vitro.
8757136 1996 Functional interaction of beta-catenin with the transcription factor LEF-1.
8631802 1996 The nuclear localization signal of lymphoid enhancer factor-1 is recognized by two differentially expressed Srp1-nuclear localization sequence receptor proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7958926 1994 Development of several organs that require inductive epithelial-mesenchymal interactions is impaired in LEF-1-deficient mice.
7657162 1995 Activation of the HIV-1 enhancer by the LEF-1 HMG protein on nucleosome-assembled DNA in vitro.
7537238 1995 Lymphoid enhancer factor 1 directs hair follicle patterning and epithelial cell fate.
2010090 1991 A thymus-specific member of the HMG protein family regulates the human T cell receptor C alpha enhancer.
1989880 1991 Identification and cloning of TCF-1, a T lymphocyte-specific transcription factor containing a sequence-specific HMG box.
1827423 1991 LEF-1, a gene encoding a lymphoid-specific protein with an HMG domain, regulates T-cell receptor alpha enhancer function [corrected].
1783375 1991 Gene for lymphoid enhancer-binding factor 1 (LEF1) mapped to human chromosome 4 (q23-q25) and mouse chromosome 3 near Egf.