Property Summary

Ligand Count 1
NCBI Gene PubMed Count 177
PubMed Score 375.19
PubTator Score 279.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Chronic Lymphocytic Leukemia 262
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 1.4
Disease Target Count Z-score Confidence
Cancer 2499 4.72 2.4
Pilomatrixoma 12 3.423 1.7
Alopecia 115 3.305 1.7

Expression

  Differential Expression (26)

Disease log2 FC p
Chronic Lymphocytic Leukemia 4.039 3.0e-11
atypical teratoid / rhabdoid tumor 1.100 4.5e-05
breast carcinoma 1.700 1.2e-04
colon cancer 1.800 4.9e-05
Common variable immunodeficiency -1.009 2.1e-02
cutaneous lupus erythematosus 1.100 4.5e-02
ductal carcinoma in situ 2.200 3.6e-04
ependymoma 1.100 3.9e-03
gastric carcinoma 2.400 1.3e-02
group 4 medulloblastoma -1.100 1.6e-02
interstitial cystitis 1.100 6.6e-04
intraductal papillary-mucinous neoplasm ... 1.400 4.6e-02
invasive ductal carcinoma 2.002 2.7e-06
lung cancer 2.700 1.1e-04
malignant mesothelioma 3.800 4.1e-08
medulloblastoma, large-cell 1.600 3.8e-02
non-small cell lung cancer 1.492 5.2e-15
ovarian cancer -1.800 5.2e-03
pancreatic cancer 2.200 1.3e-04
Pick disease 1.100 2.4e-02
primary pancreatic ductal adenocarcinoma 2.078 5.2e-03
primary Sjogren syndrome 2.200 2.6e-04
psoriasis -1.200 1.1e-03
sarcoidosis 1.200 3.6e-02
ulcerative colitis 1.800 4.8e-05
urothelial carcinoma 1.700 1.6e-02

Protein-protein Interaction (2)

Gene RIF (124)

AA Sequence

MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGH      1 - 70
EVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSN     71 - 140
KVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPP    141 - 210
LGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLM    211 - 280
HVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYE    281 - 350
LARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI                         351 - 399
//

Text Mined References (181)

PMID Year Title