Property Summary

NCBI Gene PubMed Count 31
PubMed Score 76.74
PubTator Score 61.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Amyloidosis 68 4.08 2.0

Gene RIF (19)

PMID Text
26048244 Localized LECT2 amyloidosis of the adrenal gland with coexisting MGUS: a diagnostic challenge.
25602789 LECT2 immunostain is useful in confirming subtype of amyloid within the liver in ALECT2..
25064673 First Nations people from British Columbia who presented with chronic kidney disease, were found to be due to LECT2 amyloidosis.
24892551 LECT2 is regulated by beta-catenin in HCC in both mice and men, but serum LECT2 reflects beta-catenin activity only in mice. Serum LECT2 could be a potential biomarker of HCC in patients.
24792621 The data from this study show that weak LECT2 staining should be regarded as indeterminate or a negative result and does not per se allow diagnosis of specific amyloid type. The diagnosis of LECT2 renal amyloidosis may require LMD/MS confirmation.
24522497 There were no mutations detected in the LECT2 gene, although all renal leukocyte chemotactic factor 2 amyloidosis patients tested were homozygous for the G nucleotide in a non-synonymous SNP at position 172.
24478397 These results demonstrate the involvement of LECT2 in glucose metabolism and suggest that LECT2 may be a therapeutic target for obesity-associated insulin resistance.
24451324 Amyloidosis derived from leukocyte chemotactic factor 2 (ALECT2) is a recently described disease. Here, we report the characteristics and outcome of 72 patients with renal ALECT2, which included 19 who had another kidney disease on biopsy.
24415538 ALect2 is a common cause of hepatic amyloidosis in the population of the United States, and subtyping hepatic amyloid deposits by an accurate analytic method such as MS is required for optimal clinical management of hepatic amyloidosis patients
24390366 The study indicates that serum LECT2 levels are increased by obesity and fatty liver, and suggests that LECT2 is a novel obesity-related protein.
24114941 These findings reveal a novel, specific inhibitory function of LECT2 in hepatocellular carcinoma by the direct binding and inactivation of MET.
23519812 preliminary X-ray analysis of human leukocyte cell-derived chemotaxin 2 (LECT2).
21394108 Re-expression of LECT2 significantly reduced the migration and invasion of human hepatocellular carcinoma cells in vitro and significantly reduced their growth in vivo.
20951486 LECT2-associated renal amyloidosis represents a unique and perhaps not uncommon disease, especially in Mexican Americans.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
15561249 Serum LECT2 levels may be a prognostic indicator of recovery from liver failure.
15561248 LECT2 participates in liver regeneration and injury following hepatectomy.
15239100 LECT2, which encodes a protein with chemotactic properties for human neutrophils, is a direct target gene of Wnt/beta-catenin signaling in the liver.

AA Sequence

MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPF      1 - 70
TGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIE     71 - 140
NCDSSDPTAYL                                                               141 - 151
//

Text Mined References (33)

PMID Year Title
26048244 2015 Localized LECT2 amyloidosis of the adrenal gland with coexisting MGUS: a diagnostic challenge.
25602789 2015 Globular hepatic amyloid is highly sensitive and specific for LECT2 amyloidosis.
25064673 2014 Renal leukocyte chemotactic factor 2 (LECT2) amyloidosis in First Nations people in Northern British Columbia, Canada: a report of 4 cases.
24892551 2014 Role of leukocyte cell-derived chemotaxin 2 as a biomarker in hepatocellular carcinoma.
24792621 2014 Leukocyte chemotactic factor 2 amyloidosis cannot be reliably diagnosed by immunohistochemical staining.
24522497 2014 Clinical, morphologic, and genetic features of renal leukocyte chemotactic factor 2 amyloidosis.
24478397 2014 LECT2 functions as a hepatokine that links obesity to skeletal muscle insulin resistance.
24451324 2014 Characterization and outcomes of renal leukocyte chemotactic factor 2-associated amyloidosis.
24415538 2014 Leukocyte cell-derived chemotaxin 2 (LECT2)-associated amyloidosis is a frequent cause of hepatic amyloidosis in the United States.
24390366 2013 Increased serum leukocyte cell-derived chemotaxin 2 (LECT2) levels in obesity and fatty liver.
24114941 2014 Leukocyte cell-derived chemotaxin 2 antagonizes MET receptor activation to suppress hepatocellular carcinoma vascular invasion by protein tyrosine phosphatase 1B recruitment.
23519812 2013 Crystallization and preliminary X-ray analysis of human leukocyte cell-derived chemotaxin 2 (LECT2).
23352894 2013 Leukocyte cell-derived chemotaxin 2 is a zinc-binding protein.
21394108 2011 The tumor suppressor function of LECT2 in human hepatocellular carcinoma makes it a potential therapeutic target.
20951486 2010 Leukocyte chemotactic factor 2 (LECT2)-associated renal amyloidosis: a case series.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20103838 2009 Identification and assignment of three disulfide bonds in mammalian leukocyte cell-derived chemotaxin 2 by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15561249 2004 Serum LECT2 level as a prognostic indicator in acute liver failure.
15561248 2004 Changes in serum LECT 2 levels during the early period of liver regeneration after adult living related donor liver transplantation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15243190 2004 1H, 13C, 15N resonance assignments of the cytokine LECT2.
15239100 2004 Identification of the leukocyte cell-derived chemotaxin 2 as a direct target gene of beta-catenin in the liver.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
10857804 2000 Val58Ile polymorphism of the neutrophil chemoattractant LECT2 and rheumatoid arthritis in the Japanese population.
9832057 1998 Systemic expression of a newly recognized protein, LECT2, in the human body.
9545637 1998 Molecular cloning, structural characterization, and chromosomal mapping of the human LECT2 gene.
9524238 1998 Molecular cloning of human and bovine LECT2 having a neutrophil chemotactic activity and its specific expression in the liver.
9266841 1997 Expression of a neutrophil chemotactic protein LECT2 in human hepatocytes revealed by immunochemical studies using polyclonal and monoclonal antibodies to a recombinant LECT2.
8877413 1996 Purification and primary amino acid sequence of a novel neutrophil chemotactic factor LECT2.