Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.07
PubTator Score 5.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Substance-Related Disorders 115 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.9e-07
subependymal giant cell astrocytoma 2287 1.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.500 1.9e-07
subependymal giant cell astrocytoma -1.144 1.6e-02

 Compartment GO Term (2)

AA Sequence

MVQPQTSKAESPALAASPNAQMDDVIDTLTSLRLTNSALRREASTLRAEKANLTNMLESVMAELTLLRTR      1 - 70
ARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFL     71 - 140
VSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTYKSPLRHARRAQIRKTSASNRAVRERQMLCRQLA    141 - 210
SAGTGPCPVHPASNGTSPAPALPARARNL                                             211 - 239
//

Text Mined References (9)

PMID Year Title