Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.69
PubTator Score 5.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
ovarian cancer 8491 1.9e-07
subependymal giant cell astrocytoma 2287 1.6e-02

Expression

  Differential Expression (2)

Disease log2 FC p
subependymal giant cell astrocytoma -1.144 1.6e-02
ovarian cancer -1.500 1.9e-07

AA Sequence

MVQPQTSKAESPALAASPNAQMDDVIDTLTSLRLTNSALRREASTLRAEKANLTNMLESVMAELTLLRTR      1 - 70
ARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFL     71 - 140
VSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTYKSPLRHARRAQIRKTSASNRAVRERQMLCRQLA    141 - 210
SAGTGPCPVHPASNGTSPAPALPARARNL                                             211 - 239
//

Text Mined References (9)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16093683 2005 A family of neofunctionalized Ty3/gypsy retrotransposon genes in mammalian genomes.
15716091 2005 Transposable elements as a source of genetic innovation: expression and evolution of a family of retrotransposon-derived neogenes in mammals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10591208 1999 The DNA sequence of human chromosome 22.