Property Summary

NCBI Gene PubMed Count 22
PubMed Score 19.03
PubTator Score 17.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -2.900 1.2e-08
posterior fossa group A ependymoma -3.600 1.1e-16
glioblastoma -1.600 5.9e-04
group 3 medulloblastoma -2.100 2.3e-04
atypical teratoid / rhabdoid tumor -1.300 6.1e-04
medulloblastoma, large-cell -1.600 4.3e-02
intraductal papillary-mucinous carcinoma... -1.600 2.1e-03
Breast cancer 2.400 2.6e-02
pediatric high grade glioma -1.300 8.6e-05
subependymal giant cell astrocytoma -1.724 1.6e-02
lung carcinoma 1.300 3.5e-21

Synonym

Accession O95751 Q6IAR6
Symbols Mar7
BCUR1
Mart7

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (11)

PMID Text
26637328 LDOC1 inhibits proliferation and promotes apoptosis by repressing NF-kappaB activation in papillary thyroid carcinoma
26317789 Cigarette smoke-induced promoter methylation may contribute to LDOC1 downregulation, thereby conferring oncogenic features to oral cells.
24125169 Silencing of LDOC1 is a frequent event in cervical cancer and may be of interest as a molecular marker in cervical cancer.
23775301 It has potential roles in apoptosis of well differentiated carcinoma without metastases and in neurodegeneration of Alzheimer's disease.
23362108 Silencing of BEX1 and LDOC1 by promoter hypermethylation might represent a critical event in the molecular pathogenesis of oral squamous cell carcinoma (OSCC) and the male predominance of OSCC occurrence.
22546831 The aim of this study was to evaluate the possible differential expression of LDOC1 mRNA in leucocytes of peripheral blood of Down's syndrome subjects. compared with the normal population.
21986234 Letter/Case Report: LDOC1/PARP1 are down-regulated in melanoma with repeated in-transit metastases.
21547351 Over expression of LDOC1 may explain the clinical manifestation found in patients with cryptochidism and Digeorge anomaly.
21310924 LDOC1 is dramatically down-regulated in mutated chronic lymphocytic leukemia cases compared with unmutated cases, and have identified a new splice variant, LDOC1S
15670815 MZF-1 was revealed to interact with LDOC1 and enhance the activity of LDOC1 for inducing apoptosis
12712434 These observations suggest that LDOC1 is a novel regulator of NF-kappaB that can affect the PMA or TNF-alpha-mediated pathway to apoptosis through inhibition of NF-kappaB activation in BxPC3 pancreatic cancer cells.

AA Sequence

MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQ      1 - 70
TASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDE     71 - 140
EEEDDY                                                                    141 - 146
//

Text Mined References (22)

PMID Year Title
26637328 2015 LDOC1 inhibits proliferation and promotes apoptosis by repressing NF-?B activation in papillary thyroid carcinoma.
26317789 2015 LDOC1 silenced by cigarette exposure and involved in oral neoplastic transformation.
25416956 2014 A proteome-scale map of the human interactome network.
24125169 2013 Loss of LDOC1 expression by promoter methylation in cervical cancer cells.
23775301 2013 CASP3 and LDOC-1 gene expression in a patient with carcinoma in the hairy part of the head skin and Alzheimer disease.
23362108 2013 Epigenetic regulation of the X-linked tumour suppressors BEX1 and LDOC1 in oral squamous cell carcinoma.
22546831 2012 Expression of LDOC1 mRNA in leucocytes of patients with Down's syndrome.
21986234 2012 Two proapoptotic genes are downregulated in a patient with melanoma and repeated in-transit metastases.
21547351 2011 Over expression of LDOC1 and PARP1, two pro-apoptotic genes, in a patient with cryptorchidism and DiGeorge anomaly.
21310924 2011 LDOC1 mRNA is differentially expressed in chronic lymphocytic leukemia and predicts overall survival in untreated patients.
19060904 2009 An empirical framework for binary interactome mapping.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16093683 2005 A family of neofunctionalized Ty3/gypsy retrotransposon genes in mammalian genomes.
15772651 2005 The DNA sequence of the human X chromosome.
15716091 2005 Transposable elements as a source of genetic innovation: expression and evolution of a family of retrotransposon-derived neogenes in mammals.
15670815 2005 LDOC1, a novel MZF-1-interacting protein, induces apoptosis.
15588942 2004 Protein partners of C/EBPepsilon.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12712434 2003 Leucine-zipper protein, LDOC1, inhibits NF-kappaB activation and sensitizes pancreatic cancer cells to apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10403563 1999 Identification of a novel gene, LDOC1, down-regulated in cancer cell lines.