Property Summary

NCBI Gene PubMed Count 17
PubMed Score 24.62
PubTator Score 9.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis -1.600 1.5e-07
osteosarcoma -1.263 2.6e-03
glioblastoma -1.900 1.4e-03
sonic hedgehog group medulloblastoma -2.400 8.2e-05
atypical teratoid / rhabdoid tumor -2.600 6.1e-05
medulloblastoma, large-cell -3.100 5.8e-04
primitive neuroectodermal tumor -1.700 1.2e-02
tuberculosis -2.300 9.2e-08
intraductal papillary-mucinous adenoma (... -1.800 1.5e-02
breast carcinoma 1.400 1.1e-03
interstitial cystitis 1.100 3.3e-03
pediatric high grade glioma -1.500 2.7e-03
subependymal giant cell astrocytoma -1.527 1.7e-02
Pick disease -1.400 1.8e-02
progressive supranuclear palsy -1.700 2.0e-02
ovarian cancer 2.100 1.5e-03
Down syndrome 1.300 1.0e-03

 GO Function (1)

Pathway (1)

Gene RIF (4)

PMID Text
24627487 Data suggest that C18ORF1 acts as a gatekeeper that abrogates excessive TGF-beta signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19430479 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MPEAGFQATNAFTECKFTCTSGKCLYLGSLVCNQQNDCGDNSDEENCLLVTEHPPPGIFNSELEFAQIII      1 - 70
IVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQEGCLWPSDSAAPRLGASEIMHAPRSRDR     71 - 140
FTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPN    141 - 210
RTIFDSDLIDIAMYSGGPCPPSSNSGISASTCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRSNAHRGSR    211 - 280
LQFQQNNAESTIVPIKGKDRKPGNLV                                                281 - 306
//

Text Mined References (18)

PMID Year Title
24627487 2014 C18 ORF1, a novel negative regulator of transforming growth factor-? signaling.
23180869 2014 Genome-wide association study of survival in patients with pancreatic adenocarcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19461657 2009 Analysis of a t(18;21)(p11.1;p11.1) translocation in a family with schizophrenia.
19430479 2009 Genome-wide association study of blood pressure and hypertension.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15074360 2003 C18orf1 located on chromosome 18p11.2 may confer susceptibility to schizophrenia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9479497 1998 Multiple transcriptional variants and RNA editing in C18orf1, a novel gene with LDLRA and transmembrane domains on 18p11.2.
9399696 An integrated physical map of 18p11.2: a susceptibility region for bipolar disorder.
9129712 1997 Isolation of chromosome 18-specific brain transcripts as positional candidates for bipolar disorder.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.