Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.34
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.130 5.2e-07
adult high grade glioma 1.500 3.2e-03
astrocytoma 1.600 7.2e-25
Astrocytoma, Pilocytic 2.600 1.2e-08
atypical teratoid / rhabdoid tumor 1.200 4.9e-04
ependymoma 1.800 8.3e-10
glioblastoma 2.000 3.7e-09
group 3 medulloblastoma 1.200 4.5e-02
interstitial cystitis 1.100 2.5e-02
intraductal papillary-mucinous adenoma (... -2.300 3.8e-04
intraductal papillary-mucinous carcinoma... -2.300 1.6e-03
medulloblastoma, large-cell 2.000 1.4e-02
oligodendroglioma 1.600 3.4e-16
ovarian cancer 1.300 1.9e-02
pituitary cancer -2.300 6.6e-08
primitive neuroectodermal tumor 1.300 2.6e-02
tuberculosis 1.500 7.3e-05
ulcerative colitis 1.400 4.0e-04

Gene RIF (4)

AA Sequence

MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSK      1 - 70
CGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFICDGQNNCQD     71 - 140
NSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLALVLHHQRKRNNLMTLPVHR    141 - 210
LQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSS    211 - 280
DTESLNQADLPPYRSRSGSANSASSQAASSLLSVEDTSHSPGQPGPQEGTAEPRDSEPSQGTEEV         281 - 345
//

Text Mined References (9)

PMID Year Title