Property Summary

Ligand Count 4
NCBI Gene PubMed Count 686
PubMed Score 938.94
PubTator Score 4075.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (26)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.0e-03
Breast cancer 1.200 1.4e-04
chronic rhinosinusitis -1.880 1.5e-02
cystic fibrosis 1.200 1.6e-03
ductal carcinoma in situ 1.200 2.5e-02
Gaucher disease type 1 -1.700 2.8e-02
glioblastoma 1.300 2.2e-02
group 4 medulloblastoma -1.300 1.7e-03
Hydrolethalus syndrome -1.427 2.2e-02
invasive ductal carcinoma -1.788 6.4e-03
lung adenocarcinoma -1.400 6.0e-12
lung cancer -1.800 1.6e-03
lung carcinoma -3.000 1.3e-27
non diabetic and post-ischemic heart fai... -1.300 2.2e-03
non-small cell lung cancer -1.075 5.0e-06
osteosarcoma 2.541 1.3e-03
ovarian cancer 1.100 4.1e-02
pancreatic cancer 1.100 8.5e-03
pancreatic carcinoma 1.100 8.5e-03
primary pancreatic ductal adenocarcinoma 1.149 4.6e-02
primary Sjogren syndrome -1.700 6.8e-04
psoriasis 1.600 7.7e-08
sarcoidosis -1.300 4.8e-02
spina bifida -2.250 4.0e-02
type II diabetes mellitus and post-ische... -1.100 2.3e-02
ulcerative colitis 1.300 8.7e-04

 CSPA Cell Line (4)

Protein-protein Interaction (1)

PDB (31)

Gene RIF (584)

AA Sequence

MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKS      1 - 70
GDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDE     71 - 140
ASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECI    141 - 210
HSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPN    211 - 280
KFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQR    281 - 350
RCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYT    351 - 420
SLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYW    421 - 490
TDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENI    491 - 560
QWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFS    561 - 630
ANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPD    631 - 700
GMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQ    701 - 770
ALGDVAGRGNEKKPSSVRALSIVLPIVLLVFLCLGVFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICH    771 - 840
NQDGYSYPSRQMVSLEDDVA                                                      841 - 860
//

Text Mined References (701)

PMID Year Title