Property Summary

NCBI Gene PubMed Count 9
PubMed Score 21.93
PubTator Score 51.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
glioblastoma -1.200 1.6e-06
group 4 medulloblastoma -1.700 1.1e-05
atypical teratoid / rhabdoid tumor -1.100 4.7e-06
medulloblastoma, large-cell -1.800 1.0e-06
primitive neuroectodermal tumor -1.200 1.6e-03
pancreatic ductal adenocarcinoma liver m... -1.865 1.1e-03
breast carcinoma -1.100 6.2e-03
adult high grade glioma -1.400 6.6e-05
inflammatory breast cancer -1.500 1.3e-02
gastric carcinoma -1.100 4.5e-02
ductal carcinoma in situ -1.100 8.8e-03
invasive ductal carcinoma -1.200 3.9e-02
ulcerative colitis -1.600 2.4e-06
psoriasis -1.500 1.0e-23

Protein-protein Interaction (6)

Gene RIF (7)

PMID Text
23333299 The activity and expression of the mitochondrial D-lactate dehydrogenase, is higher in prostate cancer versus normal prostate cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20499337 Elevated serum LDH isoenzymes and AST indicate a disturbance (of uncertain clinical significance) within multiple extraosseous tissues when there is CLCN7 deficiency.
19844255 Observational study of gene-disease association. (HuGE Navigator)
12127981 identification and characterization of human and mouse D-lactate dehydrogenase (NAD) [D-LDH]
11582518 A lentivirus lytic peptide 1 (LLP-1) corresponding to the carboxyl terminus of HIV-1 gp41 induces a significant lactate dehydrogenase (LDH, a marker of cell death) release from human neuronal and glial cell lines
11125887 A lentivirus lytic peptide 1 (LLP-1) corresponding to the carboxyl terminus of HIV-1 gp41 induces a significant lactate dehydrogenase (LDH, a marker of cell death) release from human neuronal and glial cell lines

AA Sequence

MARLLRSATWELFPWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVV      1 - 70
WPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQGGVCVNLTHMDRILELNQEDFSVVVEPGVTR     71 - 140
KALNAHLRDSGLWFPVDPGADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFR    141 - 210
FGFWPEIPHHTAWYSPCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQ    211 - 280
AAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNG    281 - 350
ASDFSWAKEAEERSRLWTARHNAWYAALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVG    351 - 420
HVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQ    421 - 490
LKAVLDPQGLMNPGKVL                                                         491 - 507
//

Text Mined References (10)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23665963 2013 Multidimensional prognostic risk assessment identifies association between IL12B variation and surgery in Crohn's disease.
23333299 2013 Prostate cancer cells metabolize d-lactate inside mitochondria via a D-lactate dehydrogenase which is more active and highly expressed than in normal cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20499337 2010 Elevated serum lactate dehydrogenase isoenzymes and aspartate transaminase distinguish Albers-Schönberg disease (Chloride Channel 7 Deficiency Osteopetrosis) among the sclerosing bone disorders.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12127981 2002 Identification of putative mammalian D-lactate dehydrogenase enzymes.