Property Summary

NCBI Gene PubMed Count 30
PubMed Score 512.10
PubTator Score 235.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
head and neck cancer 1.200 2.8e-02
osteosarcoma 1.044 3.7e-04

Gene RIF (11)

AA Sequence

MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSL      1 - 70
FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV     71 - 140
DILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVA    141 - 210
LKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGL    211 - 280
YGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF                      281 - 332
//

Text Mined References (31)

PMID Year Title