Property Summary

NCBI Gene PubMed Count 29
PubMed Score 505.48
PubTator Score 235.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.044 3.7e-04
head and neck cancer 1.200 2.8e-02

Synonym

Accession P07864 D3DQY4 Q6GSG8 Q7Z7J4 LDH-C
Symbols CT32
LDH3
LDHX

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (10)

PMID Text
26503549 three uniquely identified proteins (CDK6 , galectin-3-binding protein and LDH C) were found, which show tight connection with prostate cancer and presence of all of them was previously linked to certain aspects of prostate cancer
26069337 This is the first report to show a positive correlation between LDH-3 and hemolytic parameters in sickle cell anemia.
25795631 Down-regulated LDH-C4 expression is significantly correlated with lowered enzyme activity in human spermatozoa.
21858537 Results show that S-100B, MIA and LDH levels were significantly higher in patients with advanced melanoma than in disease-free patients or healthy controls.
20499337 Elevated serum LDH isoenzymes and AST indicate a disturbance (of uncertain clinical significance) within multiple extraosseous tissues when there is CLCN7 deficiency.
18930904 hLdhc expression in cancer cells was regulated by transcription factor Sp1 and CREB and promoter CGI methylation
17935709 LDH3 is a supporting diagnostic marker in cases of chronic tuberculosis.
17178662 LDH3 was increased in essential thrombocythemia. This isoenzymatic pattern could be expression of a metabolic adaptation.
11582518 A lentivirus lytic peptide 1 (LLP-1) corresponding to the carboxyl terminus of HIV-1 gp41 induces a significant lactate dehydrogenase (LDH, a marker of cell death) release from human neuronal and glial cell lines
11125887 A lentivirus lytic peptide 1 (LLP-1) corresponding to the carboxyl terminus of HIV-1 gp41 induces a significant lactate dehydrogenase (LDH, a marker of cell death) release from human neuronal and glial cell lines

AA Sequence

MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSL      1 - 70
FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV     71 - 140
DILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVA    141 - 210
LKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGL    211 - 280
YGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF                      281 - 332
//

Text Mined References (30)

PMID Year Title
26503549 2015 Differences in urinary proteins related to surgical margin status after radical prostatectomy.
26069337 2015 Lactate dehydrogenase isoenzyme 3 and hemolysis in sickle cell anemia: a possible correlation?
25795631 2015 Quick histochemical staining method for measuring lactate dehydrogenase C4 activity in human spermatozoa.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21858537 2011 Evaluation of multiple serum markers in advanced melanoma.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21124955 2010 Genome-wide association study identifies two novel regions at 11p15.5-p13 and 1p31 with major impact on acute-phase serum amyloid A.
20499337 2010 Elevated serum lactate dehydrogenase isoenzymes and aspartate transaminase distinguish Albers-Schönberg disease (Chloride Channel 7 Deficiency Osteopetrosis) among the sclerosing bone disorders.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18930904 Homo sapiens lactate dehydrogenase c (Ldhc) gene expression in cancer cells is regulated by transcription factor Sp1, CREB, and CpG island methylation.
18368308 2008 Construction of sperm-specific lactate dehydrogenase DNA vaccine and experimental study of its immunocontraceptive effect on mice.
17935709 2007 Elevated level of serum LDH2 and LDH3 in sputum three positive TB patients of Sahariya tribe: a preliminary study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17178662 2006 Increased serum lactate dehydrogenase isoenzymes in Ph-negative chronic myeloproliferative diseases: a metabolic adaptation?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14985855 2004 A spermatogenesis-related gene expression profile in human spermatozoa and its potential clinical applications.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438276 2002 Multiple splice variants of lactate dehydrogenase C selectively expressed in human cancer.
11377399 2001 Selective active site inhibitors of human lactate dehydrogenases A4, B4, and C4.
11276087 2001 Structural basis for altered activity of M- and H-isozyme forms of human lactate dehydrogenase.
8614414 1995 Posttranscriptional regulation of primate Ldhc mRNA by its AUUUA-like elements.
8318584 1993 Genomic structure and promoter activity of the human testis lactate dehydrogenase gene.
7382246 1980 On the functional significance of LDH X.
3175768 1988 Assignment of human gene encoding testis-specific lactate dehydrogenase C to chromosome 11, region p14.3-p15.5.
2930531 1989 Human testicular lactate dehydrogenase-C gene is interrupted by six introns at positions homologous to those of LDH-A (muscle) and LDH-B (heart) genes.
2844458 1987 Locus determining the human sperm-specific lactate dehydrogenase, LDHC, is syntenic with LDHA.
2596827 1989 Regional localization of the sperm-specific lactate dehydrogenase, LDHC, gene on human chromosome 11.
2440048 1987 Epitopes of human testis-specific lactate dehydrogenase deduced from a cDNA sequence.
1996957 1991 Properties of human testis-specific lactate dehydrogenase expressed from Escherichia coli.