Property Summary

NCBI Gene PubMed Count 124
PubMed Score 175.71
PubTator Score 128.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -1.334 1.6e-02
astrocytoma 1.500 3.7e-02
Astrocytoma, Pilocytic 1.500 3.9e-05
cutaneous lupus erythematosus 2.700 3.8e-04
glioblastoma 1.200 1.2e-02
head and neck cancer and chronic obstruc... 1.100 1.3e-02
interstitial cystitis 1.900 9.7e-04
intraductal papillary-mucinous carcinoma... -1.300 2.2e-02
invasive ductal carcinoma 1.917 1.0e-03
lung cancer -2.600 3.2e-05
lung carcinoma -2.800 2.6e-33
medulloblastoma, large-cell -2.000 1.5e-05
non-small cell lung cancer -1.386 3.1e-11
osteosarcoma -2.489 1.1e-02
ovarian cancer -1.800 5.0e-03
pediatric high grade glioma 1.300 1.3e-02
posterior fossa group A ependymoma 1.100 1.4e-03
primary Sjogren syndrome 2.200 3.3e-04
psoriasis 1.200 3.9e-05
Rheumatoid arthritis 1.100 1.2e-02
sarcoidosis 1.400 4.2e-02
subependymal giant cell astrocytoma 2.058 1.4e-02
ulcerative colitis 3.000 8.9e-06

Synonym

Accession Q13094 A8KA25 Q53XV4
Symbols SLP76
SLP-76

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (60)

AA Sequence

MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQ      1 - 70
EINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVE     71 - 140
DDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLP    141 - 210
PPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP    211 - 280
KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPS    281 - 350
PMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE    351 - 420
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLR    421 - 490
GKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP                               491 - 533
//

Text Mined References (127)

PMID Year Title