Property Summary

NCBI Gene PubMed Count 116
PubMed Score 172.45
PubTator Score 128.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Rheumatoid Arthritis 1.100 1.2e-02
cutaneous lupus erythematosus 2.700 3.8e-04
glioblastoma 1.900 3.7e-04
osteosarcoma -2.489 1.1e-02
astrocytoma 1.500 3.7e-02
medulloblastoma, large-cell -2.000 1.5e-05
adrenocortical carcinoma -1.334 1.6e-02
non-small cell lung cancer -1.386 3.1e-11
intraductal papillary-mucinous carcinoma... -1.300 2.2e-02
lung cancer -3.700 5.5e-06
sarcoidosis 1.400 4.2e-02
interstitial cystitis 1.900 9.7e-04
pediatric high grade glioma 1.300 1.3e-02
pilocytic astrocytoma 1.500 3.5e-05
posterior fossa group A ependymoma 1.100 1.4e-03
primary Sjogren syndrome 2.200 3.3e-04
subependymal giant cell astrocytoma 2.058 1.4e-02
invasive ductal carcinoma 1.917 1.0e-03
psoriasis 1.200 3.9e-05
lung carcinoma -2.800 2.6e-33
ulcerative colitis 3.000 8.9e-06
ovarian cancer 2.400 1.5e-04
head and neck cancer and chronic obstruc... 1.100 1.3e-02

Synonym

Accession Q13094 A8KA25 Q53XV4
Symbols SLP76
SLP-76

Gene

PANTHER Protein Class (1)

PDB

2ROR   1H3H   1YWO   2EAP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (56)

PMID Text
26321253 immune cell adaptor SLP-76 binds directly to SUMO-RanGAP1 of cytoplasmic fibrils of the nuclear pore complex, and this interaction is needed for optimal NFATc1 and NF-kappaB p65 nuclear entry in T cells
26202465 Data strongly suggest that chemokine-stimulated associations between Vav1, SLP-76, and ADAP facilitate Rac1 activation and alpha4beta1-mediated adhesion, whereas Pyk2 opposes this adhesion by limiting Rac1 activation.
26163016 TSAD binds to and co-localizes with Nck. Expression of TSAD increases both Nck-Lck and Nck-SLP-76 interaction in T cells.
25316710 SLP-76 N-terminal tyrosine residues regulate a dynamic signaling equilibrium involving feedback of proximal T-cell receptor signaling
24162774 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
23979596 Multipoint binding of SLP-76 to ADAP facilitates the assembly of SLP-76 microclusters.
23935094 Data indicate a role for the SAM domain in mediating SLP-76 self-association for T-cell function.
23901140 analysis of a costimulatory mechanism by which CXCL12 and antigen converge at SLP-76 microcluster formation to enhance T cell responses
23293025 Data indicate that the intracellular signaling of ITK-SYK requires both SLP-76 and the adapter function of SYK/ZAP-70 kinases.
23227982 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
23071622 Unique modes of regulation of positive and negative feedback pathways in T cells by SLP-76.
22902619 a novel regulation mechanism of SLP-76 by ubiquitination and proteasomal degradation of activated SLP-76, which is mediated by Ser-376 phosphorylation, leading to down-regulation of TCR signaling.
22844345 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
22806433 These findings reveal a novel role for SLP-76 in CXCR4-mediated T lymphocyte trafficking.
22802418 Nef employs a dual mechanism to disturb early TCR signaling by limiting the communication between LAT and SLP-76
22802418 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
22786724 Complementary phosphorylation sites in the adaptor protein SLP-76 promote synergistic activation of natural killer cells.
22534133 both T cell activation and the association between SLP-76 and Nck. After T cell receptor stimulation, SLP-76 was phosphorylated, which enabled the binding of Nck.
22323535 our studies demonstrate a novel role for the adaptor molecule SLP-76 in regulating HIV-1 infection in T cells
22323535 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
22323535 Knockdown of lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) (LCP2; SLP76) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
21949020 Combining regulated deletion of endogenous SLP-76 with transgenic expression of a SLP-76 SH2 domain mutant demonstrates that the SLP-76 SH2 domain is required for peripheral T cell activation and positive selection of thymocytes.
21887278 The spatial correlation between kinase ZAP70 and adaptor SLP76 microclusters (MC) at the cell periphery and the effects of F-actin on MC assembly, were analysed.
21725281 These data suggest a sequential mechanism whereby ZAP-70-dependent priming of SLP-76 at three N-terminal sites triggers reciprocal regulatory interactions between Itk and SLP-76, which are ultimately required to couple active Itk to PLC-gamma1.
21469089 findings demonstrate the critical role of SLP-76-mediated signaling in initiating T-cell-directed immune responses both in vitro and in vivo
21282515 LAT recruits Src homology 2 domain-containing leukocyte 76 kDa protein (SLP-76) following T-cell receptor ligation and membrane translocation of Akt and phosphatidylinositol 3-kinase (PI3K)phosphorylation in Jurkat cells, activating Akt signaling.
20890395 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
20842205 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
20562827 Results define the composition, stoichiometry and specificity of interactions in the SLP-76, Nck and VAV1 complex, which is crucial for regulation of the actin machinery after T-cell activation.
20534575 findings reconfigure the TCR signaling pathway by showing SLP-76 back-regulation of ZAP-70, an event that could ensure that signaling components are in balance for optimal T cell activation
20457812 T-cell receptor (TCR)-induced association between ITK and SLP-76, recruitment and transphosphorylation of ITK, actin polarization at the T-cell contact site, and expression of Th2 cytokines
20079431 The results show that Bcr-Abl regulates the actin cytoskeleton and non-apoptotic membrane blebbing via a GADS/Slp-76/Nck1 adaptor protein pathway.
19812192 SLP76 is differentially required for T cell receptor- compared to chemokine C-X-C receptor 4-mediated inside-out signaling pathways regulating T cell adhesion and migration in Jurkat T cells.
19710135 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
19667077 SLP-76 relocalizes to integrin-initiated signaling complexes by a mechanism different from that employed during TCR signaling and that SLP-76 relocalization corresponds to SLP-76-dependent integrin function in T cells.
18564921 Observational study of gene-disease association. (HuGE Navigator)
18549800 study reports that T cell costimulation by the integrin VLA-4 (alpha4beta1) required SLP-76 domains implicated in microcluster assembly
18187620 Knockdown of lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) (LCP2; SLP76) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17420479 Required for activation of IL-2-inducible T cell kinase (ITK); furthermore, an ongoing physical interaction between SLP-76 and ITK is required to maintain ITK in an active conformation.
17237383 phosphorylation of the adaptor molecule SLP-76 is essential for recruitment of the exchange factor Vav leading to Ca(2+) flux and IL-2 production
17235283 The integrity of T-cell receptor signaling in vivo is sustained both by strong selection of SLP-76 for the Gads C-SH3 domain and by a capacity to buffer intrinsic crossreactivity.
17148460 The P-I region deletion disrupted Vav association and reduced SLP-76-associated kinase activity.
16914752 The costimulatory effect of CD6 is mediated through phosphorylation-dependent binding of a specific tyrosine residue, 662Y, in its cytoplasmic region to the adaptor SLP-76.
16439309 findings show that retinoic acid(RA) induced the expression of SLP-76, which when co-expressed with an RA-induced receptor, c-FMS, enhanced RA-induced cell differentiation and G0 cell cycle arrest
16356554 In T cells all SLP-76 proteins are in a approximately 400 kDa complex with the small adaptor protein Grb2-like adaptor protein Gads.
16354835 the Lck binding region of SLP-76 is essential for T cell antigen receptor signaling and normal T cell development and function
15708849 TCR-induced association of Vav3 with SLP-76 is required for its membrane/IS localization and function
15699071 Data show that the adaptor molecules LAT and SLP-76 are specifically targeted by Yersinia to inhibit T cell activation.
15623534 SLP-76 need not interact with SH3(PLC) to activate PLC-gamma1, and the P-I region of SLP-76 serves a structural role that is sequence-independent and is not directly related to protein-protein interactions
15388330 Data suggest that SLP-76 may play a role in signaling pathways by interacting with the p85 subunit of phosphoinositide 3-kinase (PI3K).
14722089 the proline-rich domain in SLP-76 has a role in subcellular localization and T cell function
14662865 Study provides the first data to address the mechanisms controlling SLP-76 transcription by providing evidence for several key cis-regulatory elements in the promoter region.
12847255 SLP-76 is necessary for T cell receptor stimulation-induced polarization of the T cell's microtubule-organizing center, as it moves toward the interface of the T cell and antigen-presenting cell.
12817019 SLP-76 is required for intracellular calcium ion mobilization in response to SDF-1alpha/CXCL12-induced prolonged activation of extracellular signal-related protein kinase in Jurkat T cells.
12496421 SLP-76 is essential for NF-kappa B activation and lipid raft translocation of protein kinase C theta and the I kappa B kinase complex.
12084069 Shb links SLP-76 and Vav with the CD3 complex in Jurkat T cells (SLP-76)

AA Sequence

MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQ      1 - 70
EINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVE     71 - 140
DDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLP    141 - 210
PPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP    211 - 280
KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPS    281 - 350
PMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE    351 - 420
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLR    421 - 490
GKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP                               491 - 533
//

Text Mined References (120)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26321253 2015 The Immune Adaptor SLP-76 Binds to SUMO-RANGAP1 at Nuclear Pore Complex Filaments to Regulate Nuclear Import of Transcription Factors in T Cells.
26202465 2015 Positive and negative regulation by SLP-76/ADAP and Pyk2 of chemokine-stimulated T-lymphocyte adhesion mediated by integrin ?4?1.
26163016 2015 T cell specific adaptor protein (TSAd) promotes interaction of Nck with Lck and SLP-76 in T cells.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
25316710 2015 SRC homology 2 domain-containing leukocyte phosphoprotein of 76 kDa (SLP-76) N-terminal tyrosine residues regulate a dynamic signaling equilibrium involving feedback of proximal T-cell receptor (TCR) signaling.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24584089 2014 Quantitative proteomics analysis of signalosome dynamics in primary T cells identifies the surface receptor CD6 as a Lat adaptor-independent TCR signaling hub.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979596 2013 Multipoint binding of the SLP-76 SH2 domain to ADAP is critical for oligomerization of SLP-76 signaling complexes in stimulated T cells.
23935094 2013 SLP-76 sterile ? motif (SAM) and individual H5 ? helix mediate oligomer formation for microclusters and T-cell activation.
23901140 2013 The chemokine CXCL12 generates costimulatory signals in T cells to enhance phosphorylation and clustering of the adaptor protein SLP-76.
23293025 2013 Signaling of the ITK (interleukin 2-inducible T cell kinase)-SYK (spleen tyrosine kinase) fusion kinase is dependent on adapter SLP-76 and on the adapter function of the kinases SYK and ZAP70.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23071622 2012 Quantitative phosphoproteomics reveals SLP-76 dependent regulation of PAG and Src family kinases in T cells.
22902619 2012 Attenuation of T cell receptor signaling by serine phosphorylation-mediated lysine 30 ubiquitination of SLP-76 protein.
22806433 2012 SLP-76 is required for optimal CXCR4-stimulated T lymphocyte firm arrest to ICAM-1 under shear flow.
22802418 2012 HIV-1 Nef limits communication between linker of activated T cells and SLP-76 to reduce formation of SLP-76-signaling microclusters following TCR stimulation.
22786724 2012 Complementary phosphorylation sites in the adaptor protein SLP-76 promote synergistic activation of natural killer cells.
22534133 2012 Studying the dynamics of SLP-76, Nck, and Vav1 multimolecular complex formation in live human cells with triple-color FRET.
22323535 2012 The adaptor protein SLP-76 regulates HIV-1 release and cell-to-cell transmission in T cells.
22074159 2012 Improved two-dimensional reversed phase-reversed phase LC-MS/MS approach for identification of peptide-protein interactions.
21983831 2011 The kinase GLK controls autoimmunity and NF-?B signaling by activating the kinase PKC-? in T cells.
21949020 2011 The SLP-76 Src homology 2 domain is required for T cell development and activation.
21887278 2011 Spatial association of signaling proteins and F-actin effects on cluster assembly analyzed via photoactivation localization microscopy in T cells.
21725281 2011 Sequential phosphorylation of SLP-76 at tyrosine 173 is required for activation of T and mast cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21469089 2011 Conditional deletion of SLP-76 in mature T cells abrogates peripheral immune responses.
21282515 2011 Role of two adaptor molecules SLP-76 and LAT in the PI3K signaling pathway in activated T cells.
20936779 2010 A human MAP kinase interactome.
20562827 2010 Cooperative interactions at the SLP-76 complex are critical for actin polymerization.
20551903 2010 Ezrin tunes T-cell activation by controlling Dlg1 and microtubule positioning at the immunological synapse.
20534575 2010 SH2 domain containing leukocyte phosphoprotein of 76-kDa (SLP-76) feedback regulation of ZAP-70 microclustering.
20457812 2010 In vivo significance of ITK-SLP-76 interaction in cytokine production.
20079431 2010 The Bcr-Abl kinase regulates the actin cytoskeleton via a GADS/Slp-76/Nck1 adaptor protein pathway.
19812192 2009 Src homology 2-domain containing leukocyte-specific phosphoprotein of 76 kDa is mandatory for TCR-mediated inside-out signaling, but dispensable for CXCR4-mediated LFA-1 activation, adhesion, and migration of T cells.
19667077 2009 The adapter protein SLP-76 mediates "outside-in" integrin signaling and function in T cells.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
18564921 2008 Candidate gene analysis in primary lymphedema.
18549800 2008 T cell costimulation via the integrin VLA-4 inhibits the actin-dependent centralization of signaling microclusters containing the adaptor SLP-76.
18088087 2008 Phosphoproteome of resting human platelets.
17652306 2007 Keeping the (kinase) party going: SLP-76 and ITK dance to the beat.
17420479 2007 SLP-76 mediates and maintains activation of the Tec family kinase ITK via the T cell antigen receptor-induced association between SLP-76 and ITK.
17237383 2007 Mitogenic CD28 signals require the exchange factor Vav1 to enhance TCR signaling at the SLP-76-Vav-Itk signalosome.
17235283 2007 Efficient T-cell receptor signaling requires a high-affinity interaction between the Gads C-SH3 domain and the SLP-76 RxxK motif.
17148460 2007 Dual role of SLP-76 in mediating T cell receptor-induced activation of phospholipase C-gamma1.
17010654 2007 Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction.
16914752 2006 CD6 regulates T-cell responses through activation-dependent recruitment of the positive regulator SLP-76.
16511262 2006 Expression, refolding and crystallizations of the Grb2-like (GADS) C-terminal SH3 domain complexed with a SLP-76 motif peptide.
16467851 2006 Recruitment and activation of PLCgamma1 in T cells: a new insight into old domains.
16439309 2006 Retinoic acid induces expression of SLP-76: expression with c-FMS enhances ERK activation and retinoic acid-induced differentiation/G0 arrest of HL-60 cells.
16356554 2006 Two dimensional Blue Native-/SDS-PAGE analysis of SLP family adaptor protein complexes.
16354835 2005 A 10-aa-long sequence in SLP-76 upstream of the Gads binding site is essential for T cell development and function.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15929943 2005 Novel Src homology 3 domain-binding motifs identified from proteomic screen of a Pro-rich region.
15708849 2005 Membrane localization and function of Vav3 in T cells depend on its association with the adapter SLP-76.
15699071 2005 The adaptor molecules LAT and SLP-76 are specifically targeted by Yersinia to inhibit T cell activation.
15668918 2005 SLP-76 is recruited to CD22 and dephosphorylated by SHP-1, thereby regulating B cell receptor-induced c-Jun N-terminal kinase activation.
15623534 2005 T cell receptor-induced activation of phospholipase C-gamma1 depends on a sequence-independent function of the P-I region of SLP-76.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15388330 2004 Association of the Src homology 2 domain-containing leukocyte phosphoprotein of 76 kD (SLP-76) with the p85 subunit of phosphoinositide 3-kinase.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14757747 2004 Differential regulation of TCR-mediated gene transcription by Vav family members.
14722089 2004 Roles of the proline-rich domain in SLP-76 subcellular localization and T cell function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14662865 2003 Transcriptional regulation of Src homology 2 domain-containing leukocyte phosphoprotein of 76 kDa: dissection of key promoter elements.
14624253 2003 T cell receptor-independent basal signaling via Erk and Abl kinases suppresses RAG gene expression.
12847255 2003 Linker for activation of T cells, zeta-associated protein-70, and Src homology 2 domain-containing leukocyte protein-76 are required for TCR-induced microtubule-organizing center polarization.
12817019 2003 Distinct role of ZAP-70 and Src homology 2 domain-containing leukocyte protein of 76 kDa in the prolonged activation of extracellular signal-regulated protein kinase by the stromal cell-derived factor-1 alpha/CXCL12 chemokine.
12773374 2003 Structural basis for SH3 domain-mediated high-affinity binding between Mona/Gads and SLP-76.
12640123 2003 Structural requirements of SLP-76 in signaling via the high-affinity immunoglobulin E receptor (Fc epsilon RI) in mast cells.
12496421 2003 Src homology 2 domain-containing leukocyte phosphoprotein of 76 kDa and phospholipase C gamma 1 are required for NF-kappa B activation and lipid raft recruitment of protein kinase C theta induced by T cell costimulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12084069 2002 Shb links SLP-76 and Vav with the CD3 complex in Jurkat T cells.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11607830 2001 The role of Gads in hematopoietic cell signalling.
11487585 2001 Hematopoietic progenitor kinase 1 associates physically and functionally with the adaptor proteins B cell linker protein and SLP-76 in lymphocytes.
11390650 2001 Identification of a phospholipase C-gamma1 (PLC-gamma1) SH3 domain-binding site in SLP-76 required for T-cell receptor-mediated activation of PLC-gamma1 and NFAT.
11331248 2001 Requirement of tyrosine-phosphorylated Vav for morphological differentiation of all-trans-retinoic acid-treated HL-60 cells.
11301322 2001 PRAM-1 is a novel adaptor protein regulated by retinoic acid (RA) and promyelocytic leukemia (PML)-RA receptor alpha in acute promyelocytic leukemia cells.
11048639 2000 The mechanism of phospholipase C-gamma1 regulation.
10993915 2000 Involvement of LAT, Gads, and Grb2 in compartmentation of SLP-76 to the plasma membrane.
10790433 2000 Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation.
10747096 2000 Fyn-binding protein (Fyb)/SLP-76-associated protein (SLAP), Ena/vasodilator-stimulated phosphoprotein (VASP) proteins and the Arp2/3 complex link T cell receptor (TCR) signaling to the actin cytoskeleton.
10671560 2000 Functional association between SLAP-130 and SLP-76 in Jurkat T cells.
10660534 2000 Resting lymphocyte kinase (Rlk/Txk) targets lymphoid adaptor SLP-76 in the cooperative activation of interleukin-2 transcription in T-cells.
10636929 2000 Biochemical interactions integrating Itk with the T cell receptor-initiated signaling cascade.
10570256 1999 Cutting edge: SLP-76 cooperativity with FYB/FYN-T in the Up-regulation of TCR-driven IL-2 transcription requires SLP-76 binding to FYB at Tyr595 and Tyr651.
10562326 1999 Clnk, a novel SLP-76-related adaptor molecule expressed in cytokine-stimulated hemopoietic cells.
10556826 1999 Interaction of SLP adaptors with the SH2 domain of Tec family kinases.
10497204 1999 Novel isoform of lymphoid adaptor FYN-T-binding protein (FYB-130) interacts with SLP-76 and up-regulates interleukin 2 production.
10469124 1999 Evidence that phospholipase C-gamma2 interacts with SLP-76, Syk, Lyn, LAT and the Fc receptor gamma-chain after stimulation of the collagen receptor glycoprotein VI in human platelets.
10347175 1999 SLP-76 and Vav function in separate, but overlapping pathways to augment interleukin-2 promoter activity.
10229072 1999 Association of Nck with tyrosine-phosphorylated SLP-76 in activated T lymphocytes.
10224278 1999 Grf40, A novel Grb2 family member, is involved in T cell signaling through interaction with SLP-76 and LAT.
10204582 1999 Cbl functions downstream of Src kinases in Fc gamma RI signaling in primary human macrophages.
10026222 1999 Tyrosine phosphorylation of SLP-76 is downstream of Syk following stimulation of the collagen receptor in platelets.
10021361 1999 The hematopoietic-specific adaptor protein gads functions in T-cell signaling via interactions with the SLP-76 and LAT adaptors.
9846482 1998 Regulation of PAK activation and the T cell cytoskeleton by the linker protein SLP-76.
9765283 1998 SLP-76 is a direct substrate of SHP-1 recruited to killer cell inhibitory receptors.
9716598 1998 SLP-76-Cbl-Grb2-Shc interactions in FcgammaRI signaling.
9697839 1998 BLNK: a central linker protein in B cell activation.
9489702 1998 LAT: the ZAP-70 tyrosine kinase substrate that links T cell receptor to cellular activation.
9341187 1997 Identification of two tyrosine phosphoproteins, pp70 and pp68, which interact with phospholipase Cgamma, Grb2, and Vav after B cell antigen receptor activation.
9207119 1997 Cloning of a novel T-cell protein FYB that binds FYN and SH2-domain-containing leukocyte protein 76 and modulates interleukin 2 production.
9115214 1997 Molecular cloning of SLAP-130, an SLP-76-associated substrate of the T cell antigen receptor-stimulated protein tyrosine kinases.
9047237 1997 Regulation of Vav-SLP-76 binding by ZAP-70 and its relevance to TCR zeta/CD3 induction of interleukin-2.
8760799 1996 Hematopoietic cell phosphatase, SHP-1, is constitutively associated with the SH2 domain-containing leukocyte protein, SLP-76, in B cells.
8703037 1996 Differential regulation of activation-induced tyrosine phosphorylation and recruitment of SLP-76 to Vav by distinct isoforms of the CD45 protein-tyrosine phosphatase.
8702662 1996 Phosphorylation of SLP-76 by the ZAP-70 protein-tyrosine kinase is required for T-cell receptor function.
8673706 1996 Vav and SLP-76 interact and functionally cooperate in IL-2 gene activation.
8666952 1996 Implication of the GRB2-associated phosphoprotein SLP-76 in T cell receptor-mediated interleukin 2 production.
8661136 1996 Polymorphism in and localization of the gene LCP2 (SLP-76) to chromosome 5q33.1-qter.
7706237 1995 Molecular cloning of SLP-76, a 76-kDa tyrosine phosphoprotein associated with Grb2 in T cells.
7565724 1995 Wiskott-Aldrich syndrome protein physically associates with Nck through Src homology 3 domains.