Property Summary

NCBI Gene PubMed Count 487
PubMed Score 2128.77
PubTator Score 1235.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (26)

Gene RIF (455)

PMID Text
27012045 Serum NGAL may be used as an early predictor of recovery of post-transplant graft function after living donor kidney transplantation.
26968114 The ability of EGCG to mediate its inhibitory activity is counter-regulated by the presence of iron and lipocalin 2
26773532 EMMPRIN, MMP8, hyaluronan, beta-defensing-2, and neutrophil gelatinase-associated lipocalin (NGAL) are elevated in women with vaginal inflammation
26757915 Iron depletion strategy for targeted cancer therapy: utilizing the dual roles of neutrophil gelatinase-associated lipocalin protein.
26673824 Data show that kidney injury molecule (KIM)-1 and neutrophil gelatinase-associated lipocalin (NGAL), were significantly elevated in welding workers post-exposure.
26635366 Biochemical and Structural Characterization of the Interaction between the Siderocalin NGAL/LCN2 (Neutrophil Gelatinase-associated Lipocalin/Lipocalin 2) and the N-terminal Domain of Its Endocytic Receptor SLC22A17.
26632077 findings suggest that both NGAL and CysC are very sensitive markers that reflect renal impairment in newly diagnosed patients with multiple myeloma.
26629810 role of NGAL in leptospirosis acute kidney injury
26627265 children with heart failure caused by idiopathic dilated cardiomyopathy had significantly higher plasma NGAL levels than healthy controls
26626454 plasma NGAL is a valuable biological marker in the assessment of severity and prediction of prognosis of patients with sepsis
26573874 Our results also illustrate a molecular mechanistic approach for 2DG-guided molecular imaging-based cancer therapy using BRM270 as a novel cancer therapeutic drug to enhance the effect of doxorubicin (Dox)-resistant LCN2 induced metastasis
26491688 the NGAL/sCr ratio may offer useful information when screening patients with both systemic inflammation and renal dysfunction.
26464627 the expression of NGAL protein was correlated with tumorigenesis of head and neck squamous cell carcinoma, but not with regional metastasis
26393328 High NGAL and KIM-1 levels may indicate early diabetic kidney injury; however, we did not observe any relationship between these markers and diabetic indices
26390966 These findings provide insight into the mechanism by which bacteria utilize c-di-GMP to interfere with the innate immune system for survival.
26367277 LCN2 plays a pivotal role in processes involved in atherogenesis by promoting polarization and migration of monocytic cells and development of macrophages towards foam cells.
26351381 At baseline, NGAL-MMP-9 levels were significantly higher in active Crohn's disease (CD) patients vs healthy controls. After treatment, NGAL-MMP-9 levels significantly decreased in completely healed CD patients.
26350566 Lcn2 significantly promoted human pulmonary artery smooth muscle cell proliferation by activating PI3K/Akt pathway.
26350099 Finally, the effect of NGAL down-regulation on the growth of human lung adenocarcinoma was determined in BALB/c nude mice.
26324091 Urinary NGAL levels may be used as a noninvasive diagnostic marker for predicting renal scarring in reflux nephropathy.
26296821 Urinary NGAL levels were predictive of outcomes in cardiac surgical patients.
26278055 Studies indicate that when neutrophil gelatinase-associated lipocalin (NGAL) forms a complex with matrix metalloproteinase-9 (MMP-9) it increases its stability which is important in cancer metastasis.
26266256 The urinary NGAL is highly sensitive but nonspecific predictor of acute kidney injury and death in septic patients admitted into emergency room.
26259977 Study showed that the MMP9 activity was upregulated by LCN2, and both LCN2 and MMP9 are controlled by the NFkappaB pathway which results in progression and invasion of two gastric cancer cell lines.
26212793 NGAL is an independent inflammatory marker for somatic depressive symptoms in heart failure (HF) and may function as an immunopathogen linking somatic symptoms of depression to HF.
26200468 uNGAL levels may increase following PN. However, it does not appear to be a useful marker for quantifying the degree of AKI or predicting postoperative renal function in patients with normal contralateral kidney
26190820 These results imply that LCN2 promotes the migration and invasion of ESCC cells through a novel positive feedback loop.
26163623 LCN2 promoter unmethylation status was observed in 43 (67.2%) of breast cancer patients.
26161663 Low serum NGAL levels appear to be associated with current malnutrition and also its progressive worsening in maintenance hemodialysis patients.
26125566 NGAL is an early and accurate biomarker of graft function in kidney transplantation from extended criteria doors favoring tubular epithelial cell regeneration after ischemic and nephrotoxic injury.
26116587 A measurement of corrected NGAL may provide helpful information for assessing patients with renal impairment, particularly in association with systemic inflammation.
26069091 Lipocalin-2 is downregulated after lipid and carbohydrate ingestion and this kind of regulation was not predicted by age, sex, triglycerides, glucose, or insulin levels.
26053382 while pre-operative pNGAL adds prognostic value for mortality beyond routinely available serum creatinine, post-operative pNGAL measurements may not be as useful for this purpose.
26022238 These data indicate that LCN2 is an additional myelofibrosis inflammatory cytokine that likely contributes to the creation of a cascade of events that results in a predominance of the myelofibrosis clone and a dysfunctional microenvironment.
26021263 The results suggests LCN2 upregulation protects hepatocytes from IL-1beta-induced stress.
25995666 In patients with IgAN, high serum and urine NGAL levels at the time of kidney biopsy predict renal progression.
25995665 Plasma NGAL showed strong correlations with other clinical prognostic factors and was also an independent predictor of adverse renal outcome in IgA nephropathy.
25987661 In human subjects, NGAL/MMP9 was positively correlated with plasma aldosterone and fibrosis biomarkers. Treatment of human fibroblasts with recombinant Lcn2 induced collagen I and the profibrotic galectin-3 and cardiotrophin-1 expression.
25944130 Plasma and urine NGAL levels are reliable biomarkers for predicting acute kidney injury in patients with sepsis.
25943992 NGAL measurement is a sensible tool to predict AKI during hospitalization. Elevated NGAL levels appear to be related to BUN increase and post-discharge outcome.
25940797 Data show that lipocalin 2 (LCN2)-induced migration occurred through activation of the met proto-oncogene protein (Met)/focal adhesion kinase (FAK) cascade.
25939604 circulating LCN2 levels predict future risk of osteoporotic fractures requiring hospitalization.
25936881 NGAL expression levels in the lung cancer tissues were significantly higher than that in adjacent tissues.
25919009 NGAL levels mainly depend on the renal function and the duration of heart failure, but remain independent from the myocardial function.
25895828 Levels of urinary NGAL increase in patients with acute kidney injury following ICU admission.
25894565 Urine NGAL is a good screening test for the early diagnosis of Acute kidney injury
25893429 NGAL has a role in inflammation during sepsis
25890435 Whole blood NGAL is markedly increased in burn patients who develop acute kidney injury in the first week after burn injury.
25864997 higher serum concentrations in non-dipper and dipper hypertension patients compared to controls
25861985 Human urinary pH and metabolite composition strongly affect siderocalin's antibacterial activity.
25832128 Measurement of cystatin C level in both diabetic and non-diabetic patients may reveal acute kidney injury earlier than NGAL and BUN
25814363 The lipocalin-2 protein is an anti-osteoclastogenic molecule that exerts its effects by retarding the proliferation and differentiation of osteoclast lineage cells.
25806716 Urinary neutrophil gelatinase-associated lipocalin may have a role in late-onset sepsis
25790277 Plasma neutrophil gelatinase-associated lipocalin is expressed in acute pyelonephritis in children with urinary tract infections
25778333 Suggest NGAL as marker for detecting postoperative acute kidney injury.
25762211 Kidney injury molecule-1 and neutrophil gelatinase-associated lipocalin excretion rates correlated with excretion rates of other tubular damage markers and predicted outcome in patients with idiopathic membranous nephropathy
25728945 LCN2 plays a role in invasion of prostate cancer cells by inducing the epithelial-mesenchymal transition through the ERK/SLUG axis.
25727405 Postoperative serum Cys C appears to be a more specific and sensitive biomarker for NGAL-positive AKI resulting from cardiopulmonary bypass surgery in infants undergoing cardiac surgery.
25699275 We suggest that the umbilical blood NGAL concentration may be an early marker to predict Acute kidney injury in neonates with hypoplastic left heart syndrome
25685783 The NGAL levels of CHHF patients might be elevated due to increased cytokine release, the presence of a tissue injury, and the release of immature neutrophils from the bone marrow into the peripheral stream.
25684463 High NGAL expression is associated with Acute kidney injury.
25670719 A decrease in Lactobacilli and/or lactic acid plus the absence of leukocytes results in lower vaginal NGAL levels that might facilitate the growth of bacteria associated with bacterial vaginosis.
25662930 Changes in NGAL concentration 2 h after the infusion of contrast media showed marginal sensitivity to predict small increases in serum creatinine
25611655 Neutrophil gelatinase-associated lipocaline is produced by polymorphonuclear neutrophil cells and predominantly by renal tubule epithelial cells.
25607262 An increase in urine neutrophil gelatinase-associated lipocalin precedes variations in serum creatinine in patients with acute kidney injury and may be associated with death.
25599738 N-acetyl cysteine/vitamin C treatment did not alter kidney allograft function biomarkers interleukin-18 and neutrophil gelatinase-associated lipocalin.
25591790 High urine NGAL levels are associated with gastric cancer.
25566710 This study helps to better understand the different kinetics of NGAL as a biomarker in low-risk and high-risk cardiac patients
25542236 Multivariate analysis revealed significance for OS in NGAL expression and stage at diagnosis
25531230 Increased levels of NGAL were detected in patients with acute myocardial infarction, heart failure or stroke and were demonstrated to be strong predictors of adverse prognosis--{REVIEW}
25522256 Our findings suggest that Lipocalin-2 expression may be an important independent indicator of shorter survival in patients with high-grade endometrial cancer.
25509695 This study aimed to determine the cut-off level of urinary neutrophil gelatinase-associated lipocalin (UNGAL) for predicting acute kidney injury (AKI) in adult patients undergoing open cardiac surgery; studied the risk factors for AKI development.
25473804 natriuretic peptides, NGAL and sST2 testing for the prediction of worsening renal function in patients with acutely decompensated heart failure
25449518 Plasma NGAL correlated with NT-proBNP and could predict cardiovascular death in adult patients with congenital heart disease.
25444221 role in development of arterial aneurysms
25426620 Suggest urinary level of NGAL as a promising diagnostic/prognostic factor for severe acute pancreatitis in an early stage of the disease.
25424376 marker for revealing microbial invasion of the amniotic cavity leading to histological chorioamnionitis
25407832 NGAL is a valuable biomarker for prognosis of septic patients in the emergency department.
25402375 NGAL and cystatin C, known markers of renal injury, correlate with renal function decline in T1D, suggesting that they may be used as supplementary tests to urine albumin excretion in order to unmask early renal dysfunction.
25400814 Results confirm NGAL as a useful biomarker in clinical nephrology which is helpful to diagnosis and evaluate the categories for chronic kidney disease.
25398327 LCN2 is secreted by the urinary tract mucosa in response to uropathogenic E. coli challenge and acts in innate immune defenses as a colonization barrier that pathogens must overcome to establish infection.
25392341 Dexmedetomidine infusion for sedation after CABG under cardiopulmonary bypass can be useful in the prevention of kidney injury, indicated by serum NGAL levels.
25366893 Plasma NGAL diagnosed acute kidney injury and urinary NGAL predicted mortality in critically ill patients.
25343379 IL-8, NGAL and Resistin were consistently higher in severe sepsis.
25329716 urinary NGAL is a sensitive biomarker for tacrolimus-induced AKI, and may help predict renal event caused by tacrolimus therapy in liver transplant patients.
25311702 In patients with chronic kidney disease, urine levels of NGAL, a marker of renal tubular injury, were associated with future cardiovascular disease.
25284002 Plasma NGAL may serve as a useful biomarker for the early detection of acute kidney injury in adult patients following cardiopulmonary bypass.
25283849 NGAL and procalcitonin may be potential biomarkers for preeclampsia. Their levels increase significantly in preeclampsia and they are related to the severity of the disease.
25205293 Our findings suggest that NGAL and L-FABP upon ICU admission are not predictive of acute kidney injury
25199807 In systemic lupus erythematosus patients, urinary neutrophil gelatinase-associated lipocalin is a significant predictor for renal disease activity and renal flare
25195004 KIM-1 and NGAL are considered excellent biomarkers in urine and plasma for the early prediction of acute kidney injury. (Review)
25153411 Elevated uNGAL in chronic kidney disease patients is associated with risks for ESRD and probably cardiovascular events
25112732 LCN2 is a novel osteoblast mechanoresponding gene.
25088407 uNGAL is independently associated with subsequent acute kidney injury among patients with sepsis.
25066815 Serum NGAL predicts clinically significant delayed graft function in kidney transplant recipients.
25049066 NGAL levels correlate with heart failure (HF) severity and hemodynamic improvement after ventricular assist device placement. This novel biomarker is a marker of severity and prognosis in patients with HF.
25040147 In humans undergoing hepatic resection, LCN2 levels increased significantly within 24 h following surgery.
25029806 The measurement of NGAL in the umbilical blood can be a valuable biomarker of perinatal asphyxia in neonates.
25027586 When NGAL urinary levels were used to predict outcome in early renal allograft function, the accuracy rate was 90%.
25023056 Plasma and urine NGAL levels were independently associated with acute kidney injury development and mortality in burn patients.
25019387 Urinary neutrophil gelatinase-associated lipocalin levels in the donor kidney perfusate and 6 hours after transplant may be a useful predictor of delayed graft function and decreased graft function from 6 to 12 months after transplant.
25011070 Plasma NGAL level determination in recipients, but not in donors, proved to be a reliable predictor of DGF occurrence and renal function restoration, but too long for an interval to be able to compete with biomarkers currently used in clinical practice.
24985156 In critically ill patients, both plasma and urine NGAL levels can predict acute kidney injury.
24980968 Can be stimulated by Lcn2-evasive siderophores
24969771 Plasma NGAL associated strongly with all inflammatory markers (high-sensitivity C-reactive protein, total leukocyte count, neutrophil count) and inversely with estimated glomerular filtration rate.
24963810 Elevated urinary levels of NGAL is associated with Henoch-Schonlein purpura patients with renal involvement.
24954627 These analyses based on PPI network have greatly expanded our understanding of the mRNA expression profile of LCN2 overexpression for future examination of the roles and mechanisms of LCN2.
24937428 The presence of LCN2 in urine was both necessary and sufficient to control the urinary tract infection through iron sequestration, even in the harsh condition of urine acidification.
24930480 High Neutrophil gelatinase-associated lipocalin associated with irreversibility of pre-liver transplant kidney dysfunction.
24920892 Serum concentrations of LCN1 and LCN2 were both elevated in patients with COPD.
24916903 Lipocalin-2 is released by injured neurons as a "Help-me" distress signal that activates microglia and astrocytes into potentially prorecovery phenotypes.
24885531 Increased levels of lipocalin 2 in cerebrospinal fluid may discriminate between acute bacterial and viral meningitis.
24851612 A combination of early and late markers of kidney damage (urine NGAL, serum creatinine) can greatly contribute to better control the outcome of all those who are a risk group for the development of acute kidney injury.
24821156 NGAL and plasma CysC may be considered as early predictors of acute kidney injury after cardiac surgery.
24804935 Serum NGAL and cystatin C may act as early markers of contrast-induced AKI in patients undergoing percutaneous coronary intervention
24803721 Serum LCN2 levels are significantly increased in patients with psoriasis compared with healty controls.
24801557 Patients with slow coronary flow have elevated levels of NGAL.
24764155 Lcn2 is predicting lymph node metastases in OSCC, overall survival and disease-free survival.
24755339 The plasma level and biomarker value of NGAL in critically ill patients with acute kidney injury are not affected by continuous venovenous hemofiltration.
24742531 Decrease of NGAL expression is associated with metastasis in neoplasms.
24721803 Polyamination facilitates the clearance of lipocalin-2, whereas the accumulation of deamidated lipocalin-2 in arteries causes vascular inflammation, endothelial dysfunction, and hypertension.
24687388 Data suggest that up-regulation of urinary levels of NGAL, KIM1 (kidney injury molecule 1), and LFABP (liver fatty acid-binding protein) can be used as biomarkers to reflect tubular dysfunction in early-stage type 2 diabetic nephropathy.
24673459 biomarker of contrast-induced nephropathy [review]
24651681 Circulating OGN and NGAL/MMP9 complex are promising biomarkers that are expressed in vulnerable atherosclerotic plaques and may have incremental value for prediction of MACE within 1 year after coronary angiography.
24634297 High level of NGAL predicted poor disease-free survival. Thus, NGAL is a potential biomarker for the diagnosis and prognosis of colorectal cancer.
24613364 In patients with liver cirrhosis and infections, urinary NGAL level at infection diagnosis is useful in predicting clinical outcomes, specifically persistency and type of acute kidney injury, development of a second infection, and 3-month mortality.
24579085 We conclude that increased serum and urinary NGAL values are not solely a marker of AKI, and more accurately reflect the severity of inflammatory status.
24568505 LCN2 overexpression is associated with obesity and with breast cancer.
24550181 elevated in the first and second trimesters of pregnancies that later developed preeclampsia
24530115 Plasma NGAL may play a role in the development of insulin resistance in GDM, and the high levels of NGAL expression in SAT in overweight women with GDM suggests that NGAL in SAT is associated with obesity in women with GDM.
24528623 Serum NGAL levels do not differ in patients with polycystic ovary syndrome and control group.
24518829 Following hNGAL-R dependent endocytosis of CdMT/CdPC3 in colonic epithelia, a nocodazole-sensitive trafficking pathway may target CdMT, but not CdPC3, to lysosomes, causing increased colonic epithelial toxicity but reduced systemic toxicity.
24518531 the use of NGAL as a biomarker for the prediction of acute kidney injury
24508993 Plasma free and total NGAL proved to be powerful markers for acute kidney injury (AKI) in disseminated intravascular coagulation (DIC) patients and plasma free NGAL also has a prognostic relevance in DIC patients without AKI
24491219 Serum lipocalin-2 levels were significantly higher in patients with essential hypertension, and were independently associated with mean arterial pressure.
24480182 Increases in urinary NGAL predict contrast-induced kidney injury in chronic kidney disease patients.
24475761 Plasma NGAL acts like a neutrophil activation biomarker and urinary-NGAL like a tubular injury marker.
24438378 Serum IP-10 and NGAL have demonstrated good predictive ability for the development of acute kidney graft rejection at a very early time point.
24395189 NGAL concentration values measured in serum and EDTA plasma cannot be directly compared and should not be used as equivalents in studies of patients admitted to intensive care.
24391115 ERK activation-induced serine phosphorylation of both STAT1 and p65 mediated the additive effects of IFNgamma and TNFalpha on LCN2 expression.
24390241 Our results indicated that circulating lipocalin-2, produced by adipocytes, are elevated and may contribute to the development of Nonalcoholic fatty liver disease
24384771 Cystatin C, serum and urinary NGAL values were significantly higher in diabetics than in non-diabetics.
24383284 neutrophil gelatinase-associated lipocalin (NGAL) as structural marker heralds an important step in diagnosis of acute kidney injury
24375576 NGAL, IL-18, KIM-1, L-FABP, and albumin differed between etiologies and were significantly higher in patients adjudicated with acute kidney injury.
24359145 Increased serum LCN2 levels are positively correlated with the presence of coronary artery disease and metabolic syndrome in a Chinese cohort.
24325180 Urinary NGAL is a prognostic marker for graft loss after acute kidney injury in kidney transplant.
24321290 NGAL, KIM-1, pi- and alpha-GST displayed unique and mutually incomparable time dependent characteristics during the development of non-sepsis related AKI.
24316309 Silencing of AKR1C3 increases LCN2 expression and inhibits metastasis in cervical cancer.
24308223 Higher value of uNGAL in some resistant hypertension patients could have link in the repair stage after acute kidney injury and would reveal pathways that could link that and chronic kidney disease.
24305547 Monitoring of uNGAL levels not only provide the early detecting CI-AKI but also predict the severity of CI-AKI in CKD patients undergoing elective coronary procedures.
24295734 HIC1 silencing in triple-negative breast cancer drives progression through misregulation of LCN2.
24295718 In a cohort of high-risk cardiac surgery patients, preoperative urinary neutrophil gelatinase-associated lipocalin value provided prognostic information
24262504 Urinary NGAL is a valuable predictive tool of dialysis requirement and death in neonates and infants with acute kidney injury after cardiac surgery.
24240113 This study delineates the association and the downstream mechanisms of MUC4-regulated elevation of lipocalin-2 and its clinical significance for prognosis of pancreatic cancer.
24239146 Urinary NGAL is a highly sensitive and specific predictor of systemic inflammatory response syndrome for patients presenting with nephrolithiasis.
24235082 Lipocalin 2 is a potential universal marker for impaired kidney function.
24214285 Data suggest that two adipokines, lipocalin-2 (LCN2) and adipocyte fatty acid-binding protein (FABP4), function as pivotal modulators of vascular function and may be involved in pathogenesis of atherosclerosis in obese subjects. [REVIEW]
24199457 could be speculated that measurement of serum NGAL can serve as a clinically useful marker for early prediction of evolving AKI in critically-ill neonates with and without sepsis
24182633 Adjusted for confounders, NGAL plasma levels are increased in depressed older persons, without any effect of antidepressant medication and age of onset.
24172823 NGAL may serve as an adjunctive tool to improve risk prediction in patients with Shiga toxin mediated haemolytic uraemic syndrome.
24165570 Urinary KIM-1 and NGAL had a good accuracy for detecting acute kidney injury in obstructive nephropathy.
24149112 Advanced glycation end-products-elicited LCN2 expression enhanced the invasive and migratory properties of human aortic smooth muscle cells.
24133923 neutrophil gelatinase-associated lipocalin is a potent tool in the diagnosis of chronic kidney diseases and is shown to have high correlation with serum creatinine and estimated glomerular filtration rate
24123926 NGAL has a poor predictive role in evaluating acute kidney injury in patients treated with goal-directed haemodynamic therapy after major abdominal surgery
24118080 NGAL expression in oral squamous cell carcinoma cells correlated significantly with tumour cell differentiation, as shown by its specific distribution in the horn pearl-forming keratinized tumour cells.
24060429 Serum and urine NGAL are higher in pediatric burn patients with acute kidney injury compared to burn patients without kidney injury.
24054338 Urinary NGAL is a modest predictor of acute kidney injury in acute decompensated heart failure.
24052978 Current status of NGAL as the most promising novel biomarker for acute kidney injury is appraised in this review.
24052155 Tissue lipocalin-2 is more specific to psoriasis than serum lipocalin-2, but has no role in determining severity of the disease or cardiovascular risk.
24022330 Increased urinary NGAL concentration is a strong predictor of mortality in patients with stable angina undergoing percutaneous coronary intervention.
24009223 Plasma NGAL is an accurate biomarker for prediction of acute kidney injury in patients admitted from the emergency department.
23988549 Case Report: rare case of abdominal aortic aneurysm associated with multiple peripheral aneurysms, in which both plasma and tissue levels of MMP-9 and NGAL seemed to correlate with disease progression.
23972287 Data suggest LCN2 (lipocalin 2) is involved in invasiveness of placental trophoblasts and choriocarcinoma cells, especially under hypoxia; these alteration appear to be mediated, in part, via increased activity of MMP9 (matrix metalloproteinase-9).
23964619 Neither serum NGAL nor urinary NGAL level is associated with NT-proBNP in type II diabetic patients with macroalbuminuria.
23940770 r24p3-R/hNGAL-R may represent a high-affinity multi-ligand receptor for apical internalization and transcytosis of intact proteins/peptides by the lower intestine.
23936859 uNGAL cannot be used for screening of the duration of inflammation during urinary tract infection
23863624 Pulmonary LCN2 levels were tremendously elevated during bacterial pneumonia, and high LCN2 levels were indicative of a detrimental outcome from pneumonia with Gram-positive bacteria.
23838697 Peripheral monocytes secrete NGAL and serum levels are widely distributed among cystic fibrosis patients; NGAL is not a sensitive biomarker for pulmonary exacerbations.
23838135 Our study indicates that lipocalin 2 is not a suitable serum biomarker for the diagnosis of CRC.
23825078 performing muscle-damaging exercise before running in the heat results in a mild inflammatory response ), upregulation of a biomarker of kidney injury suggesting kidney stress (as assessed by NGAL
23799980 NGAL could predict mortality in patients with hepatorenal syndrome independent of other commonly used risk factors.
23799122 Circulating levels of lipocalin-2 and RBP4 are positively correlated with carotid IMT and subclinical atherosclerosis in type 2 diabetes, which suggests a role of these two lipid-binding chaperones in the pathogenesis of vascular complications of diabetes
23775308 Lipocalin-2 plays an important role in regulation of proliferation and invasion of prostate cancer.
23754672 NGAL measurement could be useful for the evaluation of early renal involvement in the course of diabetes.
23736029 NGAL expression is not a useful biomarker for determining disease progression from adenomatous to malignant colorectal neoplasia.
23735150 plasma NGAL is an excellent early biomarker for renal replacement therapy initiation in critically ill patients with AKI stage 2-3.
23726574 ). In the first days after transplantation, uNGAL could be an early marker of DGF, providing additional information to standard biomarkers and potentially helping clinicians to take early measures to mitigate DGF
23712081 Increased plasma NGAL reflects both decreased filtration and structural injury.
23696034 Lipocalin-2 negatively modulates the epithelial-to-mesenchymal transition in hepatocellular carcinoma through the epidermal growth factor (TGF-beta1)/Lcn2/Twist1 pathway.
23684135 This study evaluated and compared the ability of urinary biomarkers, including urinary neutrophil gelatinase-associated lipocalin (NGAL), cystatin C, and the urinary albumin to creatinine ratio (ACR) to predict cisplatin-induced acute kidney injury.
23673972 male, obese, hypertensive adolescents with hyperuricemia have higher urine NGAL and KIM-1 levels
23668886 The 4-hour urinary NGAL measurement is an independent predictor of stage 2 and 3 acute kidney injury after cardiac surgery.
23668802 Expression of Toll-like receptor-3 is enhanced in active inflammatory bowel disease and mediates the excessive release of lipocalin 2.
23633156 Serum NGAL levels in the inflammatory bowel disease (IBD) group is significantly higher than in healthy controls; serum NGAL levels are higher when colonic involvement is more extensive.
23627612 Plasma NGAL can help clinicians to identify bacterial infections in critically ill patients
23580616 Changes in serum NGAL could be used for the early diagnosis of contrast-induced nephropathy after coronary angiography in patients with chronic kidney disease.
23568978 Bile NGAL and serum CA19-9 were independent parameters.
23554037 Urinary NGAL is a sensitive marker of proliferative nephritis in juvenile systemic lupus erythematosus.
23439619 Plasma NGAL concentrations were significantly elevated in women with preeclampsia versus normotensive controls, and concentrations appear to be associated with the severity of the disease.
23426707 Data (from morbidly obese women undergoing bariatric surgery) suggest that expression of LCN2 in liver is up-regulated in non alcoholic fatty liver disease; LCN2 expression (in HepG2 cells) appears to be induced by cytokines/adipokines (resistin).
23406465 Neutrophil gelatinase-associated lipocalin plasma levels are no different in kidney transplant patients with BK virus-associated nephropathy versus those without BKV infection.
23403985 Overexpression of LCN2 is likely associated with radioresistance in oral cancer and lung cancer cells.
23402494 Assessment of a patient's initial blood NGAL when admitted to hospital from emergency department improved diagnosis of acute kidney injury.
23396290 Plasma and urinary Cystatin C and urinary NGAL are useful markers in predicting AKI in septic critically ill patients
23391290 In a heterogeneous group of critically ill children with established acute kidney injury (AKI), NGAL in both urine and serum discriminated intrinsic AKI from prerenal AKI.
23389669 NGAL is higher in colorectal cancer patients than in the healthy population. High NGAL levels are associated with higher neoplastic tissue volume, neoplastic invasion and recurrence.
23376114 Data indicate that serum LCN2 levels in diseased livers were significantly higher compared to controls.
23349979 Tubular markers, such as NGAL and L-FABP, may not be predictive factors associated with GFR decline in type 2 diabetic patients.
23344473 Urinary NGAL was an independent risk factor of progression among patients with established chronic kidney disease.
23343559 The NGAL gene is a rapid response gene whose expression is driven in a dose-dependent manner by different stimuli which generally induce tissue damage. (Review)
23332549 Preterm infants who developed bronchopulmonary dysplasia had a higher concentration of serum NGAL at birth than those who did not.
23327592 Serum IL-8 and urine IL-18, NGAL, IL-6, and IL-8 are elevated in AKI within the first 24 hours following liver transplantation.
23318563 The result suggest that assessment of NGAL in peritoneal fluids, especially in combination with LDH, may be a reliable approach for screening of bacterial peritonitis in patients with new onset nonmalignant ascites.
23242471 these results point to lipocalin-2 and RBP-4 as relevant mediators of the trend towards metabolic syndrome in psoriatic patients.
23207546 LCN2 is an M1-amplifier in brain microglial cells.
23179203 Our results show increased mRNA expression of STEAP4 and NGAL in human visceral adipose tissue in obese patients.
23167703 Urinary L-FABP and NGAL increased at an early stage after cardiac surgery. The combination of the two biomarkers enhanced the accuracy of the early detection of postoperative acute kidney injury after cardiac surgery before a rise in serum creatinine.
23150981 Higher lipocalin 2 expression may represent an independent favorable prognostic factor in cytogenetically normal acute myeloid leukemia.
23150684 NGAL is a novel target of nuclear factor-kappaB prometastatic activity in thyroid cancer through enhancement of MMP-9 enzymatic activity.
23146921 Data show that neutrophil gelatinase-associated lipocalin, MIC-1, and CA19-9 were significantly elevated in the pancreatic juice of chronic pancreatitis (CP) and pancreatic cancer (PC) as compared with nonpancreatic nonhealthy controls.
23128339 Low serum lipocalin levels are associated with iron deficiency anemia.
23100449 Increased NGAL expression is associated with drug response in breast cancer and colorectal cancer.
23056397 Results demonstrate that LCN2 plays an important role in the malignant progression of pancreatic ductal carcinoma and is a potential therapeutic target for this disease.
23056218 Results show that in low-risk subgroups, neutrophil gelatinase-associated lipocalin (NGAL) was found to be a predictive marker for pCR after neoadjuvant chemotherapy (NACT).
23020231 Elevated serum RBP-4 and NGAL are associated with pancreatic cancer.
22982376 results are the first to demonstrate that Lcn2 promotes angiogenesis in vitro and in vivo and suggest a novel mechanism through which Lcn2 may promote tumor progression
22976261 Urine NGAL in children with focal segmental glomerulosclerosis can be used as a marker of progression of kidney damage as expressed in its positive correlation with both declining in glomerular filtration rate and the level of proteinuria.
22965758 a novel role of Lcn2 as an important paracrine chemoattractant and an indispensable factor for neutrophil function in inflammation.
22950345 The role of neutrophil gelatinase-associated lipocalin (NGAL) in pathophysiology and diagnosis of acute kidney injury is presented. [review]
22932106 Serum LCN-2 level is closely related to the progress of preeclampsia.
22928018 role siderocalin plays in modulating iron metabolism
22923545 Chronic renovascular hypertension is associated with elevated NGAL levels, likely due to ongoing kidney and systemic inflammation and ischemia.
22876549 We do not suggest routine investigation of serum lipocalin-2 level in obese subjects for risk stratification of the obesity-related complications.
22876548 Normoalbuminuric and normotensive adolescents with type 1 diabetes have elevated urinary NGAL values, which might indicate kidney injury.
22851691 The study data point to a macrophage-dependent IL-10-STAT3-NGAL axis that might contribute to tumor progression.
22835414 Urine NGAL levels reflect renal distal tubular injury and decreased glomerular filtration rate in patient with acute decompensated heart failure.
22820397 BNP and NGAL are two emerging tools useful for diagnosis and prognosis in heart failture
22811364 Investigated serum NGAL and IL-18 for the prediction of DGF after kidney transplantation. After transplantation, serum levels of NGAL were significantly higher at any time in patients with DGF compared to those with IGF.
22800509 lipocalin 2 is a new GADD153 target gene that mediates endoplasmic reticulum stress-induced apoptosis in lung cancer cells
22767506 LCN2 and TWEAKR-TWEAK as crucial downstream effectors of NFAT1 that regulate breast cancer cell motility and invasive capacity.
22749388 Urinary NGAL levels are not associated with incident chronic kidney disease.
22728279 NGAL and NGALR expression might be served as novel prognostic factors and potential therapeutic targets in Hepatocellular carcinoma.
22724477 NGAL is an independent renal predictor of incidence of acute kidney injury following abdominal aortic aneurysm repair.
22723447 Perioperative urine neutrophil gelatinase-associated lipocalin and IL-18 are associated with poor 1-year allograft function.
22710694 NGAL and beta2-M were significantly increased in urine from patients with obstructed hydronephrotic kidneys at the time of surgery.
22707293 LCN2 overexpression can effectively induce apoptosis of HCC cells
22705926 N-GAL, cystatin C and eGFR indicate acute kidney injury and are associated with a poor 30-day prognosis in acute pulmonary embolism.
22695331 Monospecific assays of the NGAL monomer demonstrated a correlation with histology that typifies progressive, severe chronic kidney disease.
22640376 the elevated levels of lipocalin-2 and MMP-9 are associated with reduced breast cancer survival, particularly in patients with lower BMI and lymph-node negative breast cancers.
22562534 Urinary neutrophil gelatinase-associated lipocalin strongly predicts short-term inpatient mortality in both unadjusted and adjusted models.
22559235 Investigate LCN2 in endometrial cancer. Expression of LCN2 protein, found in 49% of the cases, was associated with non-endometrioid histologic type, nuclear grade 3, >50% solid tumor growth, ER and PR negativity, and positive EZH2 expression.
22537138 Urinary neutrophil gelatinase-associated lipocalin and Il-18 increase in tandem after surgical pulmonary valve replacement, and may predict acute kidney injury.
22529161 Increased NGAL urine levels are associated with acute kidney injury.
22515481 Studies indicate the most studied biomarkers for acute kidney injury are neutrophil gelatinase-associated lipocalin-2, kidney injury molecule-1, IL-18, cystatin C, N-acetyl-beta-D-glucosaminidase, liver fatty-acid binding protein, and heat shock protein 72.
22505707 Urinary vascular cell adhesion molecule, but not neutrophil gelatinase-associated lipocalin, is associated with lupus nephritis.
22500106 Multivariate logistic regression analysis and ROC curve analysis revealed that 24-hour urinary NGAL excretion is a potential biomarker for renal damage in SLE patients, with higher sensitivity and specificity than anti-dsDNA antibody titers.
22469622 We show evidence for mineralocorticid binding to an NGAL promoter, providing a mechanism for NGAL regulation.
22441986 Lcn2 was found to be significantly decreased in CSF of patients with mild cognitive impairment and Alzheimer's disease (AD) and increased in brain regions associated with AD pathology in postmortem brain tissue
22404749 High neutrophil gelatinase-associated lipocalin levels are associated with acute kidney injury in liver transplantation.
22371904 ). A significant positive relationship was found between NGAL level and creatinine level in patients with normal basal leukocyte levels but not in those with higher leukocytes.
22371224 the immunohistochemical detection of NGAL may be helpful in the differential diagnosis between malignant and benign follicular-patterned lesions of the thyroid
22340728 Elevated neutrophil gelatinase-associated lipocalin at admission is associated with in-hospital acute kidney injury and mortality in patients with Acute Decompensated Cardiac Failure.
22325322 Plasma NGAL is a novel marker of kidney function, which correlates to duration of end-stage renal failure and serum creatinine in uraemic patients awaiting kidney transplantation.
22292925 Elevated serum lipocalin-2 is closely and independently associated with impaired glucose regulation and type 2 diabetes.
22291019 Siderocalin cannot efficiently sequester ferric vibriobactin in vitro.
22251225 These results suggest the possibility of NGAL involvement in drug transportation and cancer MDR formation, and indicate the potential of NGAL in cancer therapy.
22237710 NGAL protein seems to represent a marker of malignant follicular cell-derived thyroid tumors, and especially of those with follicular architecture.
22226205 Plasma NGAL levels do not adequately predict acute kidney injury in patients with acute heart failure.
22222353 Measurement of urinary proteins is a powerful and non-invasive method to quantify the effect of patent ductus arteriosus on systemic perfusion in preterm infants.
22222228 This study investigated the prognostic value of neutrophil gelatinase-associated lipocalin (NGAL) in patients with ST-segment elevation myocardial infarction (STEMI).
22200942 Serum NGAL is elevated particularly in active inflammatory bowel disease and correlates with established markers of inflammation and disease activity, implicating its role in the pathophysiology of the disease.
22200895 NGAL levels differentiate steroid sensitive nephrotic syndrome from steroid resistance nephrotic syndrome and correlate with disease severity in steroid resistance nephrotic syndrome
22172816 NGAL prevents renal hypoxia/reoxygenation injury via inhibition of apoptosis by reducing the expression of Bax, Bcl-2, and caspase-3.
22169111 In abdominal aortic aneurysms NGAL is released by neutrophils and by the luminal part of AAA thrombus.
22164937 plasma and urinary NGAL levels increase two hours after the induction of acute kidney injury in several clinical situations such as cardiac surgery, radiocontrast nephropathy, kidney transplantation, hemolytic uremic syndrome and critically ill patients
22123561 NGAL could be a more sensitive and more specific marker than the albuminuria and might detect the early appearance of the renal lesions, and thus could be useful to prevent or reduce severity of renal function alterations.
22035911 Confirmed that density of NGAL expressing neutrophils in CCRCC was associated with poor outcome.
21986252 Imatinib mesylate therapy induces reduction in neutrophil gelatinase-associated lipocalin serum levels and increase in leptin concentrations in chronic myeloid leukemia patients in molecular remission.
21978028 Haplotype GGTCC was associated with the development of elevated BP at follow-up after adjusting for baseline age, sex, systolic blood pressure (SBP), and follow-up duration.
21947917 siderocalin Q83 exhibits differential slow dynamics upon ligand binding that we characterized by relaxation dispersion experiments.
21885675 Lipocalin 2 is not an independent predictor of metabolic and cardiovascular risk factors in young men cross-sectionally or prospectively.
21874256 NGAL expression is high in well-differentiated cancer, suggesting that NGAL may be a useful diagnostic marker of tumor-cell differentiation
21872946 Serum NGAL is an independent predictor of worst short term prognosis in patients with acute heart failure.
21855366 focuses on lipocalin 2 regulation and its relationship to cytokine and endocrine signaling pathways
21836147 Urine NGAL, but not plasma NGAL, associates with subsequent acute kidney injury and poor outcomes among children undergoing cardiac surgery.
21836143 Urine and plasma NGAL associate with subsequent acute kidney injury and poor outcomes among adults undergoing cardiac surgery.
21763306 These results suggested that SLC22A17, in cooperation with LCN2, to be involved in the acquisition of aggressive behavior among endometrial carcinoma cells.
21756891 The simultaneous increase in urinary NGAL and albumin/creatinine ratio excretion is significantly associated with the increase of left ventricular mass in low risk patients with primary hypertension.
21756081 PCOS per se is not associated with elevated lipocalin-2 levels. Weight loss induces a significant reduction in lipocalin-2 levels in overweight/obese patients with PCOS.
21741997 C/EBP zeta overexpression downregulated NGAL to inhibit migration and invasion of breast cancer.
21740336 Properties and perspectives of uNGAL and Netrin-1 for their appropriate clinical utilization.
21726963 NGAL expression was confirmed as a significant independent negative prognostic marker related to a shorter disease-free survival in stage I colorectal carcinoma
21723753 Studies indicate that molecular markers, such as cystatin C, neutrophil gelatinase-associated lipocalin (NGAL), IL-18 and kidney injury molecule-1 (KIM-1), better quantify the extent of acute ischemic and/or tubular injury than other available tools.
21691251 Data suggest that urinary neutrophil gelatinase-associated lipocalin levels at birth may have a predictive role in kidney function in very low birth weight infants.
21649922 The unfolded protein response activates Lcn2 production in human prostate cancer cells in an NF-kappaB-dependent manner.
21622717 NGAL overexpression may promote the tumorigenesis and progression of CRC.
21612443 The -110 to -79 sequence segment upstream from the transcription initiation site of Neutrophil gelatinase-associated lipocalin (NGAL) is a TPA responsive element (TRE), and its induction is controlled by CCAAT-Enhancer-Binding Protein-beta.
21576334 In summary, yersiniabactin is a virulence factor that is prevalent among carbapenemase-producing Klebsiella pneumoniae isolates and promotes respiratory tract infections through evasion of Lcn2.
21573795 NGAL is up-regulated in patients with endometrial hyperplasia to prevent the transition from hyperplasia to carcinoma.
21555394 High NGAL is associated with HIV-associated nephropathy.
21545264 data indicate that NGAL exerts its cytoprotective effect independent of HO-1 and protects cells against oxidative stress more efficiently than HO-1
21518160 Cystatin C and neutrophil gelatinase-associated lipocalin have roles in renal function after pediatric heart transplantation
21511111 NGAL detects patients with likely subclinical acute kidney injury who have an increased risk of adverse outcomes.
21463871 Increased plasma LCN2 levels during mild cognitive impairment (MCI) could be helpful in predicting the progression from MCI to Alzheimer's disease.
21457438 LCN2 expression shows clear correlation to liver damage and resulting inflammatory responses, rather than to the degree of liver fibrosis, which in fact may imply a distinct diagnostic value as an early biomarker of liver inflammation.
21442621 In conclusion, when nm23-H1 gene is knocked down in SiHa cervical cancer cells, cells migration and invasion decrease through elevated expression of lipocalin 2.
21439274 Plasma NGAL and NGAL/MMP-9 complex may act as diagnostic adjuvant biomarkers for pelvic inflammatory disease
21420718 neutrophil gelatinase-associated lipocalin expression appeared to be a significant independent negative prognostic marker related to shorter overall survival in stage I colorectal carcinoma.
21412214 Urinary NGAL is useful in classifying and stratifying patients with established acute kidney injury.
21403867 Both IL-1beta and TNF-alpha regulate NGAL expression in polymorphonuclear granulocytes of chronic hemodialysis patients.
21334721 Lipocalin-2 expression was up-regulated during tumorigenetic and developmental processes of endometrial carcinoma.
21307379 Urinary NAG (ninefold), NGAL (1.5-fold), and H-FABP (3.5-fold) were significantly elevated in normoalbuminuric diabetic patients compared with nondiabetic control subjects.
21300375 Neutrophil gelatinase-associated lipocalin has a role in development of acute kidney injury in neonates and children after cardiopulmonary bypass
21278918 Lcn-2 has a role in endometrial cancer.
21273640 Using tissue microarrays, lipocalin 2 immunoreactivity was significantly elevated in uterine cervical cancer tissues as compared with expression in high- or low-grade dysplasia or normal tissues.
21257679 High urine NGAL is associated with acute kidney injury after orthotopic liver transplantation.
21184133 This study suggested that NGAL and NGALR expression are frequently up-regulated in gliomas, and are closely associated with poor clinical outcome.
21160226 Baseline urinary NGAL is not associated with the decline in glomerular filtration rate or disease progression in patients with type 1 diabetes and diabetic nephropathy.
21150136 The present study suggests that urinary LCN2 is a novel marker of hepatic fibrosis by reflecting urine MMP-9 activity in chronic hepatitis C.
21143924 Obesity is associated with elevated serum lipocalin-2 levels. In contrast, PCOS does not appear to affect lipocalin-2 levels.
21133718 Increased serum levels of neutrophil gelatinase-associated lipocalin is associated with essential thrombocythemia and polycythemia vera
21132267 Loss of lipocalin 2 is associated with hepatocellular carcinoma.
21115620 NGAL independently associates with type 1 cardio-renal syndrome and might be a useful biomarker in the early recognition of these patients.
21104585 RBP-4, lipocalin-2 and L-PGDS do not regulate insulin sensitivity in healthy men. Rather their expression levels seemed to reflect inflammatory activity and were inversely correlated with alcohol intake and serum HDL levels.
21048034 These data indicate that lipocalin-2 expression correlates with HPV positivity of cutaneous squamous cell carcinomas.
21031541 a combination of NGAL and APACHE II predicts acute kidney injury with high sensitivity and specificity after liver transplantation
21030534 NGAL is highly expressed in atheromatous human plaques and associated with increased MMP-9 activity
20961744 mRNA levels of the novel inflammatory factors lipocalin-2, chitinase-3 like-1 and osteopontin are increased in human visceral abdominal tissue of subjects with colon cancer.
20960272 role for NGAL/MMP-9 dysregulation in renal dysfunction; moreover, gender-specific differences could support a gender contribution to pathological mechanisms or susceptibility for the development of renal complications in diabetes mellitus
20921623 Data show that lipocalin 2 was increased particularly in patients who rapidly progressed to end-stage renal failure.
20870707 Lipocalin-2 in obese prepubertal children showed a 44.7% higher concentration than that in lean children, controlling for age and sex. Lipocalin-2 concentrations did not significantly decrease after weight loss in obese patients after 2 years.
20853162 NGAL may be considered a novel stress protein, whereas MMP-7, MMP-9, and TIMP-1 may be regarded as indicators of stress response in the pediatric population on chronic dialysis
20819195 Significant upregulation of LCN2 and HAVCR1 could be detected in the delayed kidney graft funtion group. Prognostic value of the two biomarkers together with donor age ranges between 75% and 83%.
20802417 The aim of the study was to assess the prevalence of chronic kidney disease using estimated glomerular filtration rate (eGFR) and creatinine clearance according to different formulas and measurements of cystatin C and serum NGAL.
20703446 The data show that HMW-adiponectin and lipocalin-2 both have significant day/night rhythms, both with troughs at night, that these are not driven by the feeding/fasting cycle.
20680102 The aqueous humor NGAL level is increased in eyes with idiopathic acute anterior uveitis.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20620526 NGAL needs to be investigated as a potential early marker for impaired kidney function/injury in heart transplantation patients.
20596614 NGAL is expressed in several histotypes of renal tumors.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20559153 Upregulation of Lcn-2 is associated with pemetrexed responsiveness in non-small cell lung cancer cells.
20551266 Up-regulation of lipocalin 2 is associated with high-risk human papillomavirus and grade of cervical lesion at baseline.
20527084 GM-CSF contributes to the pathogenesis of RA through upregulation of NGAL in neutrophils, followed by induction of TERA, cathepsin D and TG2 in synoviocytes. NGAL and the upregulated enzymes may therefore play an important role in RA.
20512104 Neutrophil gelatinase-associated lipocalin (NGAL) may have a role in anemia [review]
20511727 Results show that lipocalin-2 levels are significantly higher in women with polycystic ovary syndrome compared to body mass index-matched controls.
20504881 Parenteral iron formulations differentially affect MCP-1, HO-1, and NGAL gene expression and renal responses to injury.
20504246 LCN2 plays a role in the pathogenesis of pre-eclampsia.
20502037 [review] role of hepcidin and NGAL in iron metabolism and its regulation, particularly in kidney disease.
20496473 Urinary NGAL shows promise as an early marker for culture-positive sepsis in very low birth weight infants.
20435938 assessing early plasma NGAL alone has limited utility for predicting acute postoperative kidney injury
20412947 Review: Measurement of neutrophil gelatinase-associated lipocalin levels in patients at risk for cardiac surgery-associated acute kidney injury can facilitate its early diagnosis.
20373132 data suggest that NGAL promotes the invasiveness of the cholangiocarcinoma cells by forming complex with MMP-9, stabilizing its activity and rendering the cancer cells to be more invasive
20363104 Measurement of plasma NGAL in patients in the first few hours after cardiopulmonary bypass is predictive of acute kidney injury.
20306447 possible role for NGAL as a prognosis-related indicator and a neoplastic tissue volume marker in patients with colorectal liver metastases
20208456 Maternal lipocalin-2 concentrations are significantly increased in preeclampsia.
20179686 Our data provide the first evidence for the potential of serum NGAL as an early marker to distinguish mild from severe acute pancreatitis.
20123318 The presence of elevated admission serum NGAL levels is associated with heightened risk of subsequent worsening of renal function in patients admitted with acute decompensated heart failure.
20101218 an earlier unknown NFAT3/LCN2 axis that critically controls motility in breast cancer
20086155 NGAL binds iron-complexed norepinephrine, indicating physiological relevance for both bacterial and human iron metabolism.
20072790 Both serum and urinary concentrations of NGAL change during the course of cyclosporine A treatment.
20068352 residual renal function and c reactive protein were predictors of NGAL in hemodialyzed
20057160 Cardiomyocytes, vascular wall cells and fibroblasts in myocarditis strongly express Lcn2/NGAL via proinflammatory cytokines
20056755 The relationship between urinary NGAL and acute kidney injury after cardiac surgery varies with baseline renal function, with optimal discriminatory performance in patients with normal preoperative function.
20030526 potential early marker for nephrotoxicity and predictor of contrast nephropathy
19951994 Upregulation of NGAL by ErbB2 through NF-kappaB activation is involved in cancer-related anemia.
19938135 NGAL concentrations obtained during surgery were highly associated with postoperative acute kidney injury in patients undergoing liver transplantation.
19904630 NGAL is a potent inducer of heme oxygenase-1 and somewhat superoxide dismutase-1 and superoxide dismutase-2.
19889214 Women with invasive ductal carcinoma exhibited increased blood levels of MMP-9, NGAL and MMP-9/NGAL comlex compared to healthy controls.
19887608 LCN2 is a critical factor in enhancing breast tumor formation and progression possibly in part by stabilizing matrix metalloproteinase-9
19875582 LCN2 is highly expressed in adipose tissue in vivo and in vitro, and its secretion is regulated by the activation of inflammation and infection
19863663 findings are consistent with an important role for siderocalin in protection against Mycobacterium tuberculosis infection
19857721 Plasma NGAL is not a specific biomarker for monitoring chronic renal disorders after heart and lung transplantation.
19850388 NGAL level appears to be of diagnostic and prognostic value for acute kidney injury.
19732769 these data suggest that induction of Lcn2/NGAL is an adaptive response to ameliorate the injuries induced by thermal stresses.
19727808 Neutrophil gelatinase-associated lipocalin (NGAL/Lcn2) is upregulated in gastric mucosa infected with Helicobacter pylori.
19714584 Serial measurement of urinary and plasma NGAL levels may be valuable in predicting impending worsening of global and renal childhood-onset systemic lupus erythematosus disease activity.
19708926 High NGAL is associated with impaired kidney function in renal allograft recipients.
19680166 analysis of reference values for urinary neutrophil gelatinase-associated lipocalin in very low birth weight infants
19661117 NGAL represents an early biomarker of renal failure in patients undergoing cardiac surgery.
19649660 Early prediction of urinary tract infection with LCN2/NGAL is reported.
19638718 It is a siderophore-binding protein, which involves in hematopoiesis to cell differentiation, tissue injury, carcinogenesis and infection. (review)
19549696 Neutrophil gelatinase-associated lipocalin (NGAL) reflects iron status in haemodialysis patients.
19540040 Review: discuss the contradictory, sometimes even paradoxical, effects attributed to NGAL in human neoplasias.
19474273 In adult cardiac surgery patients, the predictive value of NGAL increases with grade of acute kidney injury (AKI).
19466389 Protein expression levels of lipocalin-2 are upregulated in visceral adipose tissue of obese subjects along with increased activity of matrix metalloproteinase-2 and matrix metalloproteinase-9/ lipocalin-2 complex.
19454345 The host molecule lipocalin-2 sequesters bacterial siderophores as a mechanism of protection against infection.
19419554 NGAL mRNA up-regulation was correlated with tumor progression and MMP-9 expression in rectal cancer.
19342674 lipocalin 2 is a crucial component of mucosal immune defense against pulmonary infection with Klebsiella pneumoniae
19321980 NGAL may play an important role in the pathophysiology of renal adaptation to diabetes, probably as a defensive mechanism aiming to mitigate tubular suffering.
19308044 important regulatory molecule in colon carcinomas that integrates extracellular environment cues, iron metabolism, and intracellular small GTPase signaling in cancer migration and invasion
19287180 Neutrophil gelatinase-associated lipocalin (NGAL) represents a novel, sensitive marker of kidney function in adult patients with chronic heart failure and normal serum creatinine.
19249502 NGAL should be investigated as a potential early, sensitive marker of kidney impairment/injury in chronic kidney disease and kidney transplantation.
19249501 A potential early marker for delayed kidney graft function, especially in the settings of early dialysis treatment or antirejection therapy.
19237579 Lcn2 promotes breast cancer progression by inducing epithelial to mesenchymal transition through the ERalpha/Slug axis and may be a useful biomarker of breast cancer.
19201208 Urinary NGAL was not different in patients undergoing off-pump and on-pump coronary artery bypass surgery
19176795 In patients with chronic kidney disease, NGAL closely reflects the entity of renal impairment and represents a strong and independent risk marker for disease progression.
19148711 Serum levels increase in peritonitis
19148153 LCN2 levels reflect damage to glomeruli, proximal tubules, and distal nephrons.
19092815 in the setting of chronic kidney diseases, elevated urine NGAL levels are associated with the development of acute kidney injury.
19055468 Urinary NGAL can be used from the 1st day of injury as a reliable predictor of early acute kidney injury in multi-trauma patients.
19015448 The NGAL mRNA and NGAL protein were highly expressed in the nasal polyps. The ratio of NGAL mRNA to glyceraldehyde-3-phosphate dehydrogenase mRNA in the nasal polyps was greater compared with that in the normal turbinate mucosa.
18927283 Overexpression of lipocalin-2 is associated with barrett's esophagus-associated high-grade dysplasia.
18852336 Lipocalin-2 is upregulated by insulin via phosphatidylinositol 3-kinase and mitogen-activated protein kinase signaling pathways.
18809975 a biomarker in acute kidney injury
18803290 LCN2 is a gene with moderate CpG-density showing a less stringent relationship between DNA methylation and gene expression.
18798264 We generated human monoclonal antibodies against 2 potential tumor targets, NGAL and GW112, and we proved their selective expression in cancer colon and not or barely in healthy tissues.
18768801 NF-kappaB contributes to thyroid tumor cell survival by controlling iron uptake via NGAL
18753796 NGAL may play a key role in tubular adaptations to persistent macroproteinuria
18710473 There was no significant change in the lipocalin-2 and RBP4 levels, although IL-6 levels increased after the exercise programme in obese women
18676832 results suggest that NGAL reduces adhesion/invasion partly by suppressing FAK activation and inhibits angiogenesis partly by blocking VEGF production in pancreatic cancer cells
18663364 lipocalin 2 has at least two functions related to tumorigenesis, one involving apoptosis induction of normal hematopoietic cells and the other being tissue invasion by leukemia cells.
18600028 both serum NGAL and urinary NGAL were correlated with serum creatinine and, inversely, with residual glomerular filtration rate
18464118 parallel expression of NGAL and BCR-ABL at the early stage of CML
18437016 NGAL has a role in the maintenance of skin homeostasis
18398717 model that describes the role of lipocalin 2 in the initial stages of the bone marrow after the appearance of the Philadelphia chromosome-positive cells that expresses the Bcr-Abl oncoprotein
18393169 The association between serum lipocalin-2 and obesity or metabolic syndrome was not validated in this study.
18392050 NGAL is highly expressed in early dysplastic lesions in the pancreas, suggesting a possible role as an early diagnostic marker for pancreatic cancer.
18375251 adult beta-thalassemia patients upregulated NGAL expression compared to normal samples; no upregulation was observed in pediatric patients; upregulation may play an important role in decreasing reactive oxygen species or iron in beta-thalassemia patients
18362300 NGAL and MMP-9/NGAL complex suppression might have a protective role in women with PCOS.
18337554 Urine NGAL is an early predictive biomarker of acute kidney injury severity after cardiopulmonary bypass.
18317594 selectively induce Neutrophil gelatinase expression in sebaceous glands might represent therapeutic alternatives to the use of 13-cis retinoic acid to treat individuals with acne
18287807 We conclude that urinary IL-18 or NGAL could be early biomarkers of CIN and that urinary IL-18 is well associated with the later cardiac outcomes in patients after coronary angiography.
18275504 Hypertension is associated with kidney injury as reflected by elevated serum NGAL and cystatin C.
18070344 Plasma NGAL is an early predictive biological marker of acute kidney disease, morbidity and mortality following pediatric cardiac surgery.
18064607 Lineage-specific role for LCN2 in human hematopoiesis that is reminiscent of its effects upon mouse hematopoiesis. Important in vivo function of LCN2 in the regulation of human hematopoiesis.
18001501 Review validates the role of neutrophil gelatinase-associated lipocalin (NGAL) as an early biomarker of acute kidney injury (AKI) that rises significantly in AKI patients before the rise in creatinine is seen.
17949711 Results show that neutrophil gelatinase-associated lipocalin (NGAL or lipocalin-2)is co-expressed with migration stimulating factor (MSF) by keratinocytes and acts as a functional inhibitor of MSF.
17907186 NGAL protects MMP-9 activity and is relevant to cartilage matrix degradation in OA,may represent mechanism by which NGAL contributes to the loss of cartilage matrix proteins in osteoarthritis.
17901710 NGAL may represent a sensitive early biomarker of renal impairment after percutaneous coronary interventions.
17874137 NGAL is an early predictive biomarker of contrast-induced nephropathy in children.
17847728 NGAL mRNA transcripts were detected in salivary gland tissue with chronic sialadenitis; only a small amount was detected in tissues from normal salivary glands; results imply that NGAL is associated with regulation of inflammation in salivary glands
17721627 NGAL in complex with activated MMP-9 is present in AAA wall and thrombus.
17570904 Autosomal-dominant polycystic kidney disease patients with higher cystic growth presented higher sNGAL and uNGAL levels.
17554627 NGAL expression is a predictor of poor prognosis in primary human breast cancer
17530720 Urinary lipocalin-2 is a potential marker of the presence and severity of renal involvement in adult patients with systemic lupus erythematosus.
17360238 Findings suggest the promising use of urinary NGAL as an early biomarker for tubulointerstitial injury of IgA nephropathy and perhaps other types of renal disease in general.
17294443 NGAL may be a good marker to monitor changes of benign to premalignant and malignant ovarian tumors and that the molecule may be involved in the progression of epithelial ovarian malignancies
17253959 NGAL (neutrophil gelatinase-associated lipocalin) receptor-3 may act as a potential NGAL receptor and play a role in NGAL-mediated iron transport in oesophageal carcinoma[neutrophil gelatinase-associated lipocalin receptor]
17229907 dual effects of NGAL as a siderophore:iron-binding protein and as a growth factor and examines the role of these effects in renal injury [REVIEW]
17114340 Lipocalin 2 can suppress the ras-induced expression of vascular endothelial growth factor in 4T1 cells via down-regulation of ras mitogen-activated protein kinase and ras phosphatidylinositol-3-kinase signaling.
16827865 urine NGAL and interleukin 18 represent early, predictive biomarkers of delayed graft function
16798734 a detailed analysis of the 24p3 promoter;24p3 is regulated primarily at the level of transcription rather than mRNA stability
16733850 The analysis of PLAT and LCN2 transcripts in 12 samples obtained through EUS-guided FNA from patients with pancreatic adenocarcinoma showed significantly increased expression levels in comparison with those found in normal tissues.
16671099 4-HPR markedly induces LCN2 expression, but this event may not represent an apoptotic response
16381001 NGAL may be a candidate metastasis suppressor in colon cancer cells
16374475 LCN2 may have multifunctional roles in the maintenance of skin homeostasis.
16254208 NGAL/24p3 is increased in atherosclerotic plaques and myocardial infarction
16146540 major differences exist between mouse and man with regards to the role of NGAL in myelopoiesis and inflammation
16061852 NGAL may play an important role in breast cancer in vivo by protecting MMP-9 from degradation, thereby enhancing its enzymatic activity and facilitating angiogenesis and tumor growth
16060857 The role of NGAL on chemically-induced apoptosis in tumor cell lines is reported.
15711640 Data show that Ngal protects the kidney and mitigates azotemia during ischemia-reperfusion injury.
15691834 These data characterize lipocalin 2 as an epithelial inducer in Ras malignancy and a suppressor of metastasis.
15670845 is endocytosed by megalin, and this endocytosis is blocked by an antibody against megalin
12473066 the transient interfollicular NGAL expression during skin embryogenesis along with the induction of NGAL in adult parakeratotic epidermis suggests it play a role in epithelial differentiation pathways
11986950 up-regulated by the AML1-MTG8 fusion protein, suggesting a role in the granulocytic maturation characteristic of the t(8;21) acute myelogenous leukemia

AA Sequence

MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQK      1 - 70
MYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAM     71 - 140
VFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG                141 - 198
//

Text Mined References (494)

PMID Year Title
27012045 2016 Serum Neutrophil Gelatinase-Associated Lipocalin and Cystatin C for Assessing Recovery of Graft Function in Patients Undergoing Living-Donor Kidney Transplantation.
26968114 2016 Epigallocatechin-3-Gallate Inhibition of Myeloperoxidase and Its Counter-Regulation by Dietary Iron and Lipocalin 2 in Murine Model of Gut Inflammation.
26773532 2016 Vaginal Inflammation: Association between Leukocyte Concentration and Levels of Immune Mediators.
26757915 2016 Iron depletion strategy for targeted cancer therapy: utilizing the dual roles of neutrophil gelatinase-associated lipocalin protein.
26673824 2015 Urinary neutrophil gelatinase-associated lipocalin is associated with heavy metal exposure in welding workers.
26635366 2016 Biochemical and Structural Characterization of the Interaction between the Siderocalin NGAL/LCN2 (Neutrophil Gelatinase-associated Lipocalin/Lipocalin 2) and the N-terminal Domain of Its Endocytic Receptor SLC22A17.
26632077 2016 Neutrophil Gelatinase--Associated Lipocalin and Cystatin C Are Sensitive Markers of Renal Injury in Patients With Multiple Myeloma.
26629810 2015 Neutrophil Gelatinase Associated Lipocalin (NGAL) in Leptospirosis Acute Kidney Injury: A Multicenter Study in Thailand.
26627265 2016 Plasma levels of neutrophil gelatinase-associated lipocalin in children with heart failure.
26626454 2016 Value of plasma neutrophil gelatinase-associated lipocalin in predicting the mortality of patients with sepsis at the emergency department.
26573874 2016 Epigenetic induction of epithelial to mesenchymal transition by LCN2 mediates metastasis and tumorigenesis, which is abrogated by NF-?B inhibitor BRM270 in a xenograft model of lung adenocarcinoma.
26491688 2015 Significance of Neutrophil Gelatinase-Associated Lipocalin Level-to-Serum Creatinine Ratio for Assessing Severity of Inflammation in Patients with Renal Dysfunction.
26464627 2015 Down-regulation of neutrophil gelatinase-associated lipocalin in head and neck squamous cell carcinoma correlated with tumorigenesis, not with metastasis.
26393328 2016 Kidney injury molecule-1 and neutrophil gelatinase associated lipocalin in normoalbuminuric diabetic children.
26390966 2015 Cyclic diguanylate monophosphate directly binds to human siderocalin and inhibits its antibacterial activity.
26367277 2015 Lipocalin (LCN) 2 Mediates Pro-Atherosclerotic Processes and Is Elevated in Patients with Coronary Artery Disease.
26351381 2015 Serum Neutrophil Gelatinase B-associated Lipocalin and Matrix Metalloproteinase-9 Complex as a Surrogate Marker for Mucosal Healing in Patients with Crohn's Disease.
26350566 2015 Activation of the phosphatidylinositol 3-kinase/Akt pathway is involved in lipocalin-2-promoted human pulmonary artery smooth muscle cell proliferation.
26350099 2015 Down-regulation of lipocalin 2 suppresses the growth of human lung adenocarcinoma through oxidative stress involving Nrf2/HO-1 signaling.
26324091 2016 Role of new biomarkers for predicting renal scarring in vesicoureteral reflux: NGAL, KIM-1, and L-FABP.
26296821 2015 Urinary Neutrophil Gelatinase-Associated Lipocalin as Predictor of Short- or Long-Term Outcomes in Cardiac Surgery Patients.
26278055 2016 Roles of NGAL and MMP-9 in the tumor microenvironment and sensitivity to targeted therapy.
26266256 2015 Sepsis and AKI in Clinical Emergency Room Patients: The Role of Urinary NGAL.
26259977 2015 HGF mediated upregulation of lipocalin 2 regulates MMP9 through nuclear factor-?B activation.
26212793 2015 NGAL and other markers of inflammation as competitive or complementary markers for depressive symptom dimensions in heart failure.
26200468 2015 Accuracy of Urinary Neutrophil Gelatinase-Associated Lipocalin in Quantifying Acute Kidney Injury after Partial Nephrectomy in Patients with Normal Contralateral Kidney.
26190820 2015 Lipocalin 2 promotes the migration and invasion of esophageal squamous cell carcinoma cells through a novel positive feedback loop.
26163623 2015 LCN2 Promoter Methylation Status as Novel Predictive Marker for Microvessel Density and Aggressive Tumor Phenotype in Breast Cancer Patients.
26161663 2015 Low Serum Neutrophil Gelatinase-associated Lipocalin Level as a Marker of Malnutrition in Maintenance Hemodialysis Patients.
26125566 2015 Neutrophil Gelatinase Associated Lipocalin Is an Early and Accurate Biomarker of Graft Function and Tissue Regeneration in Kidney Transplantation from Extended Criteria Donors.
26116587 2015 Corrected Neutrophil Gelatinase-Associated Lipocalin (NGAL) Level Adjusted by the Scoring System of an Inflammation Index for Screening Renal Dysfunction in Patients with Systemic Inflammation.
26069091 2016 Short-Term Regulation of Lipocalin-2 but not RBP-4 During Oral Lipid Tolerance Test and Oral Glucose Tolerance Test.
26053382 2015 Association of Perioperative Plasma Neutrophil Gelatinase-Associated Lipocalin Levels with 3-Year Mortality after Cardiac Surgery: A Prospective Observational Cohort Study.
26022238 2015 Lipocalin produced by myelofibrosis cells affects the fate of both hematopoietic and marrow microenvironmental cells.
26021263 2015 Lipocalin 2 Upregulation Protects Hepatocytes from IL1-?-Induced Stress.
25995666 2015 High serum and urine neutrophil gelatinase-associated lipocalin levels are independent predictors of renal progression in patients with immunoglobulin A nephropathy.
25995665 2015 Plasma neutrophil gelatinase-associated lipocalin as a potential predictor of adverse renal outcomes in immunoglobulin A nephropathy.
25987661 2015 Neutrophil Gelatinase-Associated Lipocalin, a Novel Mineralocorticoid Biotarget, Mediates Vascular Profibrotic Effects of Mineralocorticoids.
25944130 2015 Diagnostic value of neutrophil gelatinase-associated lipocalin, cystatin C, and soluble triggering receptor expressed on myeloid cells-1 in critically ill patients with sepsis-associated acute kidney injury.
25943992 2015 Comparison of Neutrophil Gelatinase-Associated Lipocalin Versus B-Type Natriuretic Peptide and Cystatin C to Predict Early Acute Kidney Injury and Outcome in Patients With Acute Heart Failure.
25940797 2015 Thyroid hormone-mediated regulation of lipocalin 2 through the Met/FAK pathway in liver cancer.
25939604 2015 Circulating Lipocalin 2 Levels Predict Fracture-Related Hospitalizations in Elderly Women: A Prospective Cohort Study.
25936881 2015 [Effect of Inhibiting NGAL Gene Expression on A549 Lung Cancer Cell Migration and Invasion].
25919009 2015 NGAL and ST2 levels in ambulatory patients with chronic heart failure. Clinical and echocardiographic correlates.
25895828 2015 Urinary neutrophil gelatinase-associated lipocalin identifies critically ill young children with acute kidney injury following intensive care admission: a prospective cohort study.
25894565 2015 Urine neutrophil gelatinase-associated lipocalin in asphyxiated neonates: a prospective cohort study.
25893429 2015 Plasma Neutrophil Gelatinase-Associated Lipocalin Is Primarily Related to Inflammation during Sepsis: A Translational Approach.
25890435 2015 Whole blood neutrophil gelatinase-associated lipocalin predicts acute kidney injury in burn patients.
25864997 2015 Serum neutroph?l gelat?nase-assoc?ated l?pocal?n levels in patients with non-dipper hypertension.
25861985 2015 Human Urinary Composition Controls Antibacterial Activity of Siderocalin.
25832128 2015 Renal effects of coronary artery bypass graft surgery in diabetic and non-diabetic patients: a study with urinary neutrophil gelatinase-associated lipocalin and serum cystatin C.
25814363 2015 Lipocalin-2 inhibits osteoclast formation by suppressing the proliferation and differentiation of osteoclast lineage cells.
25806716 2015 Urinary neutrophil gelatinase-associated lipocalin: potential biomarker for late-onset sepsis.
25790277 2015 Plasma neutrophil gelatinase-associated lipocalin predicts acute pyelonephritis in children with urinary tract infections.
25778333 The effect of anaesthetic management on neutrophil gelatinase associated lipocalin (NGAL) levels after robotic surgical oncology.
25762211 2016 Kidney injury molecule-1 and neutrophil gelatinase-associated lipocalin as prognostic markers in idiopathic membranous nephropathy.
25728945 2015 Over-expression of lipocalin 2 promotes cell migration and invasion through activating ERK signaling to increase SLUG expression in prostate cancer.
25727405 Serum Cystatin C as an Early Marker of Neutrophil Gelatinase-associated Lipocalin-positive Acute Kidney Injury Resulting from Cardiopulmonary Bypass in Infants with Congenital Heart Disease.
25699275 2015 Umbilical neutrophil gelatinase-associated lipocalin level as an early predictor of acute kidney injury in neonates with hypoplastic left heart syndrome.
25685783 2015 Clinical significance of neutrophil gelatinase-associated lipocalin in Crimean-Congo hemorrhagic Fever.
25684463 2015 Predictive role of neutrophil gelatinase-associated lipocalin in early diagnosis of platin-induced renal injury.
25670719 2015 Neutrophil Gelatinase-Associated Lipocalin Concentration in Vaginal Fluid: Relation to Bacterial Vaginosis and Vulvovaginal Candidiasis.
25662930 2015 Relative and absolute changes in urinary neutrophil gelatinase-associated lipocalin and correlation with small increases in serum creatinine levels after coronary angiography: an observational study.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25611655 2015 Assessment of neutrophil gelatinase-associated lipocalin in the brain-dead organ donor to predict immediate graft function in kidney recipients: a prospective, multicenter study.
25607262 Urinary NGAL in patients with and without acute kidney injury in a cardiology intensive care unit.
25599738 2015 Effect of N-acetyl cysteine and vitamin C on kidney allograft function biomarkers interleukin-18 and neutrophil gelatinase-associated lipocalin.
25591790 2015 Urinary ADAM12 and MMP-9/NGAL complex detect the presence of gastric cancer.
25566710 Urinary neutrophil gelatinase-associated lipocalin time course during cardiac surgery.
25542236 2015 Neutrophil gelatinase-associated lipocalin (NGAL) and matrix metalloproteinase-9 (MMP-9) prognostic value in lung adenocarcinoma.
25531230 2014 Diagnostic and prognostic utility of neutrophil gelatinase-associated lipocalin (NGAL) in patients with cardiovascular diseases--review.
25522256 2015 Lipocalin-2 and matrix metalloproteinase-9 expression in high-grade endometrial cancer and their prognostic value.
25509695 2014 Determination of urinary neutrophil gelatinase-associated lipocalin (NGAL) cut-off level for early detection of acute kidney injury in Thai adult patients undergoing open cardiac surgery.
25473804 2015 Comparison between admission natriuretic peptides, NGAL and sST2 testing for the prediction of worsening renal function in patients with acutely decompensated heart failure.
25449518 2014 Clinical and prognostic implications of plasma NGAL and NT-proBNP in adult patients with congenital heart disease.
25444221 2015 The role of matrix metalloproteinases and neutrophil gelatinase-associated lipocalin in central and peripheral arterial aneurysms.
25426620 2015 Urinary neutrophil gelatinase-associated lipocalin as an early predictor of disease severity and mortality in acute pancreatitis.
25424376 2016 Microbial invasion and histological chorioamnionitis upregulate neutrophil-gelatinase associated lipocalin in preterm prelabor rupture of membranes.
25407832 2014 Diagnostic and prognostic value of neutrophil gelatinase-associated lipocalin, matrix metalloproteinase-9, and tissue inhibitor of matrix metalloproteinases-1 for sepsis in the Emergency Department: an observational study.
25402375 NGAL and cystatin C: two possible early markers of diabetic nephropathy in young patients with type 1 diabetes mellitus: one year follow up.
25400814 2014 Clinical application of neutrophil gelatinase-associated lipocalin in the revised chronic kidney disease classification.
25398327 2014 Lipocalin 2 imparts selective pressure on bacterial growth in the bladder and is elevated in women with urinary tract infection.
25392341 2015 The dose-related effects of dexmedetomidine on renal functions and serum neutrophil gelatinase-associated lipocalin values after coronary artery bypass grafting: a randomized, triple-blind, placebo-controlled study.
25366893 2014 The clinical utility window for acute kidney injury biomarkers in the critically ill.
25343379 2014 Sustained elevation of resistin, NGAL and IL-8 are associated with severe sepsis/septic shock in the emergency department.
25329716 2014 Urinary neutrophil gelatinase-associated lipocalin: a useful biomarker for tacrolimus-induced acute kidney injury in liver transplant patients.
25311702 2015 Urine neutrophil gelatinase-associated lipocalin and risk of cardiovascular disease and death in CKD: results from the Chronic Renal Insufficiency Cohort (CRIC) Study.
25284002 2015 Usefulness of plasma neutrophil gelatinase-associated lipocalin as an early marker of acute kidney injury after cardiopulmonary bypass in Korean cardiac patients: a prospective observational study.
25283849 2015 Relationship of neutrophil gelatinase-associated lipocalin (NGAL) and procalcitonin levels with the presence and severity of the preeclampsia.
25205293 2015 Neutrophil gelatinase-associated lipocalin and liver-type fatty acid-binding protein as biomarkers for acute kidney injury after organ transplantation.
25199807 2015 Predictive role of urinary neutrophil gelatinase-associated lipocalin in lupus nephritis.
25195004 2015 Biomarkers of renal function, which and when?
25153411 2015 Urinary neutrophil gelatinase-associated lipocalin and clinical outcomes in chronic kidney disease patients.
25112732 2015 Lipocalin 2: a new mechanoresponding gene regulating bone homeostasis.
25088407 2014 Urine neutrophil gelatinase-associated lipocalin in septic patients with and without acute kidney injury.
25066815 2014 Serum neutrophil gelatinase-associated lipocalin and recovery of kidney graft function after transplantation.
25049066 2014 Neutrophil gelatinase-associated lipocalin and cystatin C for the prediction of clinical events in patients with advanced heart failure and after ventricular assist device placement.
25040147 2015 The role of lipocalin-2 in liver regeneration.
25029806 2014 Umbilical cord blood NGAL concentration as an early marker of perinatal asphyxia in neonates.
25027586 2014 Non-inferiority of creatinine excretion rate to urinary L-FABP and NGAL as predictors of early renal allograft function.
25023056 2014 Assessment of biochemical markers in the early post-burn period for predicting acute kidney injury and mortality in patients with major burn injury: comparison of serum creatinine, serum cystatin-C, plasma and urine neutrophil gelatinase-associated lipocalin.
25019387 2014 Urinary neutrophil gelatinase-associated lipocalin and the occurrence of delayed graft function after kidney transplant.
25011070 2014 Is plasma and urine neutrophil gelatinase-associated lipocalin (NGAL) determination in donors and recipients predictive of renal function after kidney transplantation?
24985156 2014 Plasma and urine neutrophil gelatinase-associated lipocalin in the diagnosis of new onset acute kidney injury in critically ill patients.
24980968 2014 Bacterial siderophores that evade or overwhelm lipocalin 2 induce hypoxia inducible factor 1? and proinflammatory cytokine secretion in cultured respiratory epithelial cells.
24969771 2014 Plasma neutrophil gelatinase-associated lipocalinin in the general population: association with inflammation and prognosis.
24963810 2014 Elevated urinary levels of cystatin C and neutrophil gelatinase-associated lipocalin in Henoch-Schönlein purpura patients with renal involvement.
24954627 2014 Network based analyses of gene expression profile of LCN2 overexpression in esophageal squamous cell carcinoma.
24937428 2014 ?-Intercalated cells defend the urinary system from bacterial infection.
24930480 2014 Neutrophil gelatinase-associated lipocalin associated with irreversibility of pre-liver transplant kidney dysfunction.
24920892 2014 Increased serum levels of lipocalin-1 and -2 in patients with stable chronic obstructive pulmonary disease.
24916903 2014 Neuronal production of lipocalin-2 as a help-me signal for glial activation.
24885531 2014 Lipocalin 2 in cerebrospinal fluid as a marker of acute bacterial meningitis.
24851612 2014 Importance of determination of urine neutrophile gelatinase associated lipocalin in early detection of acute kidney injury.
24821156 2014 Plasma neutrophil gelatinase-associated lipocalin (NGAL) and plasma cystatin C (CysC) as biomarker of acute kidney injury after cardiac surgery.
24804935 2014 Serum neutrophil gelatinase associated lipocalin (NGAL) and cystatin C as early predictors of contrast-induced acute kidney injury in patients undergoing percutaneous coronary intervention.
24803721 2014 Assessment of lipocalin 2, clusterin, soluble tumor necrosis factor receptor-1, interleukin-6, homocysteine, and uric acid levels in patients with psoriasis.
24801557 2014 The relationship between neutrophil gelatinase-associated lipocalin levels and the slow coronary flow phenomenon.
24764155 2015 Nodal metastasis and survival in oral cancer: Association with protein expression of SLPI, not with LCN2, TACSTD2, or THBS2.
24755339 2014 The plasma level and biomarker value of neutrophil gelatinase-associated lipocalin in critically ill patients with acute kidney injury are not affected by continuous venovenous hemofiltration and anticoagulation applied.
24742531 2014 Roles of neutrophil gelatinase-associated lipocalin (NGAL) in human cancer.
24721803 2014 Deamidated lipocalin-2 induces endothelial dysfunction and hypertension in dietary obese mice.
24687388 2014 Nonalbuminuric proteinuria as a biomarker for tubular damage in early development of nephropathy with type 2 diabetic patients.
24673459 2014 Neutrophil gelatinase-associated lipocalin (NGAL): a promising biomarker of contrast-induced nephropathy after computed tomography.
24651681 2014 Circulating osteoglycin and NGAL/MMP9 complex concentrations predict 1-year major adverse cardiovascular events after coronary angiography.
24634297 2014 Clinical significance of neutrophil gelatinase-associated lipocalin (NGAL) in colorectal cancer: a meta-analysis.
24613364 2014 Urinary neutrophil gelatinase-associated lipocalin predicts kidney outcome and death in patients with cirrhosis and bacterial infections.
24579085 2014 Serum and urinary NGAL in septic newborns.
24568505 2014 Effect of NUCKS-1 overexpression on cytokine profiling in obese women with breast cancer.
24550181 2014 Maternal serum levels of neutrophil gelatinase-associated lipocalin (NGAL), matrix metalloproteinase-9 (MMP-9) and their complex MMP-9/NGAL in pregnancies with preeclampsia and those with a small for gestational age neonate: a longitudinal study.
24530115 2014 The changes of neutrophil gelatinase-associated lipocalin in plasma and its expression in adipose tissue in pregnant women with gestational diabetes.
24528623 2014 Epicardial adipose tissue thickness and NGAL levels in women with polycystic ovary syndrome.
24518829 2014 Differential transcytosis and toxicity of the hNGAL receptor ligands cadmium-metallothionein and cadmium-phytochelatin in colon-like Caco-2 cells: implications for in vivo cadmium toxicity.
24518531 2014 Neutrophil gelatinase-associated lipocalin as a biomarker of acute kidney injury: a critical evaluation of current status.
24508993 2014 Diagnostic and prognostic significance of neutrophil gelatinase-associated lipocalin in disseminated intravascular coagulation.
24491219 2014 Lipocalin-2, A-FABP and inflammatory markers in relation to flow-mediated vasodilatation in patients with essential hypertension.
24480182 2014 Novel preprocedural and acute-phase postprocedural predictive factors for contrast-induced kidney injury in CKD patients.
24475761 2014 Neutrophil gelatinase-associated lipocalin after off pump versus on pump coronary artery surgery.
24438378 2014 The use of NGAL and IP-10 in the prediction of early acute rejection in highly sensitized patients following HLA-incompatible renal transplantation.
24395189 2014 Serum and plasma neutrophil gelatinase associated lipocalin (NGAL) levels are not equivalent in patients admitted to intensive care.
24391115 2014 The induction of lipocalin-2 protein expression in vivo and in vitro.
24390241 2014 Serum lipocalin-2, cathepsin S and chemerin levels and nonalcoholic fatty liver disease.
24384771 2013 Assessment of kidney function in diabetic patients. Is there a role for new biomarkers NGAL, cystatin C and KIM-1?
24383284 2013 [Neutrophil gelatinase-associated lipocalin as a new diagnostic tool for acute kidney injury].
24375576 2014 Kidney biomarkers and differential diagnosis of patients with cirrhosis and acute kidney injury.
24359145 2013 Serum lipocalin-2 levels positively correlate with coronary artery disease and metabolic syndrome.
24325180 2014 Urinary neutrophil gelatinase-associated lipocalin predicts graft loss after acute kidney injury in kidney transplant.
24321290 2013 Time of injury affects urinary biomarker predictive values for acute kidney injury in critically ill, non-septic patients.
24316309 2014 Clinical implications of aldo-keto reductase family 1 member C3 and its relationship with lipocalin 2 in cancer of the uterine cervix.
24308223 2013 Importance of urinary NGAL, serum creatinine standardization and estimated glomerular filtration rate in resistant hypertension.
24305547 2013 Urinary Neutrophil Gelatinase-Associated Lipocalin predicts the severity of contrast-induced acute kidney injury in chronic kidney disease patients undergoing elective coronary procedures.
24295734 2014 HIC1 silencing in triple-negative breast cancer drives progression through misregulation of LCN2.
24295718 2014 Preoperative urinary neutrophil gelatinase-associated lipocalin and outcome in high-risk heart failure patients undergoing cardiac surgery.
24262504 2014 Predictive performance of urine neutrophil gelatinase-associated lipocalin for dialysis requirement and death following cardiac surgery in neonates and infants.
24240113 2014 MUC4-mediated regulation of acute phase protein lipocalin 2 through HER2/AKT/NF-?B signaling in pancreatic cancer.
24239146 2014 Urinary neutrophil gelatinase-associated lipocalin, a biomarker for systemic inflammatory response syndrome in patients with nephrolithiasis.
24235082 2014 The inflammation-lipocalin 2 axis may contribute to the development of chronic kidney disease.
24214285 2014 Mechanism and clinical evidence of lipocalin-2 and adipocyte fatty acid-binding protein linking obesity and atherosclerosis.
24199457 2012 Serum neutrophil gelatinase-associated lipocalin as a predictor of acute kidney injury in critically-ill neonates.
24182633 2013 Neutrophil gelatinase-associated lipocalin: a novel inflammatory marker associated with late-life depression.
24172823 2014 Serum neutrophil gelatinase-associated lipocalin (NGAL) in patients with Shiga toxin mediated haemolytic uraemic syndrome (STEC-HUS).
24165570 2014 Diagnostic performance of urinary kidney injury molecule-1 and neutrophil gelatinase-associated lipocalin for acute kidney injury in an obstructive nephropathy patient.
24149112 2013 Lipocalin-2 elicited by advanced glycation end-products promotes the migration of vascular smooth muscle cells.
24133923 2013 Concentration of plasma neutrophil gelatinase-associated lipocalin in patients with chronic kidney disease.
24123926 2014 Neutrophil gelatinase-associated lipocalin and albuminuria as predictors of acute kidney injury in patients treated with goal-directed haemodynamic therapy after major abdominal surgery.
24118080 2014 Stromal expression of neutrophil gelatinase-associated lipocalin correlates with poor differentiation and adverse prognosis in oral squamous cell carcinoma.
24060429 2014 Neutrophil gelatinase associated lipocalin as an indicator of acute kidney injury and inflammation in burned children.
24054338 2013 Novel urinary biomarkers in detecting acute kidney injury, persistent renal impairment, and all-cause mortality following decongestive therapy in acute decompensated heart failure.
24052978 2013 [Performance neutrophil gelatinase-associated lipocalin in clinical settings].
24052155 2014 Estimation of tissue and serum lipocalin-2 in psoriasis vulgaris and its relation to metabolic syndrome.
24022330 2013 Does neutrophil gelatinase-asociated lipocalin have prognostic value in patients with stable angina undergoing elective PCI? A 3-year follow-up study.
24009223 2013 Plasma NGAL for the diagnosis of AKI in patients admitted from the emergency department setting.
23988549 2013 Increased plasma levels of metalloproteinase-9 and neutrophil gelatinase-associated lipocalin in a rare case of multiple artery aneurysm.
23972287 2013 Lipocalin2 enhances the matrix metalloproteinase-9 activity and invasion of extravillous trophoblasts under hypoxia.
23964619 2013 NGAL and NT-proBNP levels in diabetic patients with macroproteinuria.
23940770 2013 Expression and function of the lipocalin-2 (24p3/NGAL) receptor in rodent and human intestinal epithelia.
23936859 2013 Clinical application neutrophil gelatinase-associated lipocalin and kidney injury molecule-1 as indicators of inflammation persistence and acute kidney injury in children with urinary tract infection.
23863624 2013 Lipocalin 2 deactivates macrophages and worsens pneumococcal pneumonia outcomes.
23838697 2013 Peripheral monocytes derived from patients with cystic fibrosis and healthy donors secrete NGAL in response to Pseudomonas aeruginosa infection.
23838135 2013 Performance of serum lipocalin 2 as a diagnostic marker for colorectal cancer.
23825078 2013 Exercising in a hot environment with muscle damage: effects on acute kidney injury biomarkers and kidney function.
23799980 2014 Neutrophil gelatinase-associated lipocalin in prediction of mortality in patients with hepatorenal syndrome: a prospective observational study.
23799122 2013 Circulating lipocalin-2 and retinol-binding protein 4 are associated with intima-media thickness and subclinical atherosclerosis in patients with type 2 diabetes.
23775308 2013 Knockdown of lipocalin-2 suppresses the growth and invasion of prostate cancer cells.
23754672 2013 "Normoalbuminuric" diabetic nephropathy: tubular damage and NGAL.
23736029 2013 Expression of neutrophil gelatinase-associated lipocalin in colorectal neoplastic progression: a marker of malignant potential?
23735150 2013 Potential role of neutrophil gelatinase-associated lipocalin in identifying critically ill patients with acute kidney injury stage 2-3 who subsequently require renal replacement therapy.
23726574 2013 Urinary neutrophil gelatinase-associated lipocalin after kidney transplantation: is it a good biomarker to assess delayed graft function?
23712081 2013 The clinical utility of plasma neutrophil gelatinase-associated lipocalin in acute kidney injury.
23696034 2013 Lipocalin-2 negatively modulates the epithelial-to-mesenchymal transition in hepatocellular carcinoma through the epidermal growth factor (TGF-beta1)/Lcn2/Twist1 pathway.
23684135 2013 Urinary neutrophil gelatinase-associated lipocalin levels predict cisplatin-induced acute kidney injury better than albuminuria or urinary cystatin C levels.
23673972 2013 Urine NGAL and KIM-1 in children and adolescents with hyperuricemia.
23668886 2013 Neutrophil gelatinase-associated lipocalin (NGAL) for the early detection of cardiac surgery associated acute kidney injury.
23668802 2013 Expression of Toll-like receptor-3 is enhanced in active inflammatory bowel disease and mediates the excessive release of lipocalin 2.
23633156 2013 Relationship between neutrophil gelatinase-associated lipocalin (NGAL) levels and inflammatory bowel disease type and activity.
23627612 2013 Association of plasma neutrophil gelatinase-associated lipocalin (NGAL) with sepsis and acute kidney dysfunction.
23580616 2014 Serum neutrophil gelatinase-associated lipocalin and cystatin C are early biomarkers of contrast-induced nephropathy after coronary angiography in patients with chronic kidney disease.
23568978 2013 Differentiation of pancreatobiliary cancer from benign biliary strictures using neutrophil gelatinase-associated lipocalin.
23554037 2013 Urinary neutrophil gelatinase-associated lipocalin as a marker of severe lupus nephritis in children.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23439619 2013 Circulating levels of neutrophil gelatinase-associated lipocalin (NGAL) correlate with the presence and severity of preeclampsia.
23426707 2013 Liver lipocalin 2 expression in severely obese women with non alcoholic fatty liver disease.
23406465 BK virus-associated nephropathy: neutrophil gelatinase-associated lipocalin as a new diagnostic tool?
23403985 2013 Lipocalin-2 is associated with radioresistance in oral cancer and lung cancer cells.
23402494 2013 Additive value of blood neutrophil gelatinase-associated lipocalin to clinical judgement in acute kidney injury diagnosis and mortality prediction in patients hospitalized from the emergency department.
23396290 2013 The use of plasma and urine neutrophil gelatinase associated lipocalin (NGAL) and Cystatin C in early diagnosis of septic acute kidney injury in critically ill patients.
23391290 2013 Neutrophil gelatinase-associated lipocalin as a follow-up marker in critically ill pediatric patients with established acute kidney injury.
23389669 2013 Prognostic value of serum neutrophil gelatinase-associated lipocalin in metastatic and nonmetastatic colorectal cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23376114 2013 Protective effects of lipocalin-2 (LCN2) in acute liver injury suggest a novel function in liver homeostasis.
23349979 2013 Clinical value of NGAL, L-FABP and albuminuria in predicting GFR decline in type 2 diabetes mellitus patients.
23344473 2013 Urine neutrophil gelatinase-associated lipocalin levels do not improve risk prediction of progressive chronic kidney disease.
23343559 2013 Genomics and biological activity of neutrophil gelatinase-associated lipocalin in several clinical settings.
23332549 2013 Serum neutrophil gelatinase-associated lipocalin as a predictor of the development of bronchopulmonary dysplasia in preterm infants.
23327592 2013 Urine IL-18, NGAL, IL-8 and serum IL-8 are biomarkers of acute kidney injury following liver transplantation.
23318563 2013 Assessment of neutrophil gelatinase-associated lipocalin and lactate dehydrogenase in peritoneal fluids for the screening of bacterial peritonitis.
23242471 2013 Circulating levels of lipocalin-2 and retinol-binding protein-4 are increased in psoriatic patients and correlated with baseline PASI.
23207546 2013 Secreted protein lipocalin-2 promotes microglial M1 polarization.
23179203 2013 Six-transmembrane epithelial antigen of prostate 4 and neutrophil gelatinase-associated lipocalin expression in visceral adipose tissue is related to iron status and inflammation in human obesity.
23167703 2013 Urinary L-FABP and its combination with urinary NGAL in early diagnosis of acute kidney injury after cardiac surgery in adult patients.
23150981 2013 Higher lipocalin 2 expression may represent an independent favorable prognostic factor in cytogenetically normal acute myeloid leukemia.
23150684 2013 NGAL controls the metastatic potential of anaplastic thyroid carcinoma cells.
23146921 2013 Neutrophil gelatinase-associated lipocalin, macrophage inhibitory cytokine 1, and carbohydrate antigen 19-9 in pancreatic juice: pathobiologic implications in diagnosing benign and malignant disease of the pancreas.
23128339 2013 Low serum lipocalin levels in patients with iron deficiency anemia.
23100449 2012 Effects of ectopic expression of NGAL on doxorubicin sensitivity.
23056397 2012 Lipocalin2 promotes invasion, tumorigenicity and gemcitabine resistance in pancreatic ductal adenocarcinoma.
23056218 2012 Neutrophil gelatinase-associated lipocalin (NGAL) predicts response to neoadjuvant chemotherapy and clinical outcome in primary human breast cancer.
23020231 2012 Serum retinol binding protein-4 and neutrophil gelatinase-associated lipocalin are interrelated in pancreatic cancer patients.
22982376 2013 Lipocalin 2 is a novel regulator of angiogenesis in human breast cancer.
22976261 2012 Urine neutrophil gelatinase-associated lipocalin and kidney injury in children with focal segmental glomerulosclerosis.
22965758 2012 Lipocalin-2 ameliorates granulocyte functionality.
22950345 2012 Neutrophil gelatinase-associated lipocalin in acute kidney injury.
22932106 2012 [Correlation of lipocalin-2 and its receptor expressions with preeclampsia].
22928018 2012 Siderocalin/Lcn2/NGAL/24p3 does not drive apoptosis through gentisic acid mediated iron withdrawal in hematopoietic cell lines.
22923545 2012 Chronic renovascular hypertension is associated with elevated levels of neutrophil gelatinase-associated lipocalin.
22876549 2012 The association of serum lipocalin-2 levels with metabolic and clinical parameters in obese children: a pilot study.
22876548 2012 Evaluation of neutrophil gelatinase-associated lipocalin in normoalbuminuric normotensive type 1 diabetic adolescents.
22851691 2012 Interleukin-10-induced neutrophil gelatinase-associated lipocalin production in macrophages with consequences for tumor growth.
22835414 2012 Relation of systemic and urinary neutrophil gelatinase-associated lipocalin levels to different aspects of impaired renal function in patients with acute decompensated heart failure.
22820397 2012 Natriuretic peptides and NGAL in heart failure: does a link exist?
22811364 2012 Serum neutrophil gelatinase-associated lipocalin and interleukin-18 as predictive biomarkers for delayed graft function after kidney transplantation.
22800509 2012 Lipocalin 2, a new GADD153 target gene, as an apoptosis inducer of endoplasmic reticulum stress in lung cancer cells.
22767506 2012 Lipocalin 2, the TNF-like receptor TWEAKR and its ligand TWEAK act downstream of NFAT1 to regulate breast cancer cell invasion.
22749388 2012 Associations of urinary levels of kidney injury molecule 1 (KIM-1) and neutrophil gelatinase-associated lipocalin (NGAL) with kidney function decline in the Multi-Ethnic Study of Atherosclerosis (MESA).
22728279 2012 NGAL and NGALR overexpression in human hepatocellular carcinoma toward a molecular prognostic classification.
22724477 2013 Neutrophil gelatinase-associated lipocalin (NGAL) and endothelial progenitor cells (EPCs) evaluation in aortic aneurysm repair.
22723447 2012 Association between peritransplant kidney injury biomarkers and 1-year allograft outcomes.
22710694 2012 Urinary NGAL, cystatin C, ?2-microglobulin, and osteopontin significance in hydronephrotic children.
22707293 2012 Lipocalin-2 induces apoptosis in human hepatocellular carcinoma cells through activation of mitochondria pathways.
22705926 2012 Neutrophil gelatinase-associated lipocalin, cystatin C and eGFR indicate acute kidney injury and predict prognosis of patients with acute pulmonary embolism.
22695331 2012 NGAL (Lcn2) monomer is associated with tubulointerstitial damage in chronic kidney disease.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22640376 2012 The association between the preoperative serum levels of lipocalin-2 and matrix metalloproteinase-9 (MMP-9) and prognosis of breast cancer.
22562534 2012 Urinary neutrophil gelatinase-associated lipocalin predicts mortality and identifies acute kidney injury in cirrhosis.
22559235 2012 Lipocalin 2 expression is associated with aggressive features of endometrial cancer.
22537138 Urinary interleukin-18 and urinary neutrophil gelatinase-associated lipocalin predict acute kidney injury following pulmonary valve replacement prior to serum creatinine.
22529161 2013 Urinalysis is more specific and urinary neutrophil gelatinase-associated lipocalin is more sensitive for early detection of acute kidney injury.
22515481 2012 Are recently reported biomarkers helpful for early and accurate diagnosis of acute kidney injury?
22505707 2012 Urinary vascular cell adhesion molecule, but not neutrophil gelatinase-associated lipocalin, is associated with lupus nephritis.
22500106 2012 Urinary neutrophil gelatinase-associated lipocalin is a potential biomarker for renal damage in patients with systemic lupus erythematosus.
22469622 2012 Neutrophil gelatinase-associated lipocalin is a novel mineralocorticoid target in the cardiovascular system.
22441986 2012 Lipocalin 2: novel component of proinflammatory signaling in Alzheimer's disease.
22404749 Neutrophil gelatinase-associated lipocalin as an early biomarker of acute kidney injury in liver transplantation.
22371904 2012 The relationship between serum neutrophil gelatinase-associated lipocalin and renal function in patients with vancomycin treatment.
22371224 2012 Diagnostic value of neutrophil gelatinase-associated lipocalin (NGAL) immunoexpression in follicular-patterned lesions of the thyroid gland.
22340728 2012 Neutrophil Gelatinase-Associated Lipocalin (NGAL) predicts renal injury in acute decompensated cardiac failure: a prospective observational study.
22325322 2012 Plasma neutrophil gelatinase associated lipocalin (NGAL) is associated with kidney function in uraemic patients before and after kidney transplantation.
22292925 2012 Lipocalin-2, glucose metabolism and chronic low-grade systemic inflammation in Chinese people.
22291019 2012 Unique iron coordination in iron-chelating molecule vibriobactin helps Vibrio cholerae evade mammalian siderocalin-mediated immune response.
22251225 2012 Neutrophil gelatinase-associated lipocalin regulates intracellular accumulation of Rh123 in cancer cells.
22237710 2012 Neutrophil gelatinase-associated lipocalin (NGAL) immunohistochemical expression in follicular cell-derived thyroid tumors: a novel diagnostic tool?
22226205 2012 Plasma neutrophil gelatinase-associated lipocalin for the prediction of acute kidney injury in acute heart failure.
22222353 2012 Urinary NT-proBNP, NGAL, and H-FABP may predict hemodynamic relevance of patent ductus arteriosus in very low birth weight infants.
22222228 2012 Prognostic significance of neutrophil gelatinase-associated lipocalin in ST-segment elevation myocardial infarction.
22200942 2012 Neutrophil gelatinase-associated lipocalin (NGAL) in inflammatory bowel disease: association with pathophysiology of inflammation, established markers, and disease activity.
22200895 2012 NGAL distinguishes steroid sensitivity in idiopathic nephrotic syndrome.
22172816 2011 Protective effects of neutrophil gelatinase-associated lipocalin on hypoxia/reoxygenation injury of HK-2 cells.
22169111 2012 Increased plasma levels of NGAL, a marker of neutrophil activation, in patients with abdominal aortic aneurysm.
22164937 2011 [Neutrophil gelatinase-associated lipocalin (NAGL): a novel biomarker for acute kidney injury].
22123561 [NGAL: a biomarker of acute and chronic renal dysfunction].
22035911 2011 [The neutrophil gelatinase-associated lipocalin, or LCN 2, marker of aggressiveness in clear cell renal cell carcinoma].
21986252 2012 Imatinib mesylate therapy induces reduction in neutrophil gelatinase-associated lipocalin serum levels and increase in leptin concentrations in chronic myeloid leukemia patients in molecular remission.
21978028 2011 Role of genetic variants in the gene encoding lipocalin-2 in the development of elevated blood pressure.
21947917 2011 Siderocalin Q83 exhibits differential slow dynamics upon ligand binding.
21885675 2011 Circulating lipocalin 2 is associated with body fat distribution at baseline but is not an independent predictor of insulin resistance: the prospective Cyprus Metabolism Study.
21874256 2011 Up-regulation of neutrophil gelatinase-associated lipocalin in oral squamous cell carcinoma: relation to cell differentiation.
21872946 2013 Prognostic value of neutrophil gelatinase-associated lipocalin in acute heart failure.
21855366 2011 Lipocalin 2 regulation and its complex role in inflammation and cancer.
21836147 2011 Postoperative biomarkers predict acute kidney injury and poor outcomes after pediatric cardiac surgery.
21836143 2011 Postoperative biomarkers predict acute kidney injury and poor outcomes after adult cardiac surgery.
21763306 2011 Immunohistochemical detection of a specific receptor for lipocalin2 (solute carrier family 22 member 17, SLC22A17) and its prognostic significance in endometrial carcinoma.
21756891 2011 Combined use of urinary neutrophil gelatinase-associated lipocalin (uNGAL) and albumin as markers of early cardiac damage in primary hypertension.
21756081 2012 Weight loss significantly reduces serum lipocalin-2 levels in overweight and obese women with polycystic ovary syndrome.
21741997 2011 C/EBP ? targets to neutrophil gelatinase-associated lipocalin (NGAL) as a repressor for metastasis of MDA-MB-231 cells.
21740336 2011 Urine neutrophil gelatinase-associated lipocalin (uNGAL) and netrin-1: are they effectively improving the clinical management of sepsis-induced acute kidney injury (AKI)?
21726963 2011 Neutrophil gelatinase-associated lipocalin (NGAL) and matrix metalloproteinase-9 (MMP-9) prognostic value in stage I colorectal carcinoma.
21723753 2013 Molecular markers of kidney injury.
21691251 2011 Urinary neutrophil gelatinase-associated lipocalin at birth predicts early renal function in very low birth weight infants.
21649922 2011 ER stress drives Lipocalin 2 upregulation in prostate cancer cells in an NF-?B-dependent manner.
21622717 2011 NGAL expression is elevated in both colorectal adenoma-carcinoma sequence and cancer progression and enhances tumorigenesis in xenograft mouse models.
21612443 2011 Neutrophil gelatinase-associated lipocalin in gastric carcinoma cells and its induction by TPA are controlled by C/EBP?.
21576334 2011 Klebsiella pneumoniae yersiniabactin promotes respiratory tract infection through evasion of lipocalin 2.
21573795 2012 The cancer marker neutrophil gelatinase-associated lipocalin is highly expressed in human endometrial hyperplasia.
21555394 2011 Urinary NGAL is a useful clinical biomarker of HIV-associated nephropathy.
21545264 2011 Neutrophil gelatinase-associated lipocalin: a new antioxidant that exerts its cytoprotective effect independent on Heme Oxygenase-1.
21518160 2011 Cystatin C and neutrophil gelatinase-associated lipocalin as markers of renal function in pediatric heart transplant recipients.
21511111 2011 The outcome of neutrophil gelatinase-associated lipocalin-positive subclinical acute kidney injury: a multicenter pooled analysis of prospective studies.
21463871 2011 Increased plasma levels of lipocalin 2 in mild cognitive impairment.
21457438 2011 Induction of lipocalin-2 expression in acute and chronic experimental liver injury moderated by pro-inflammatory cytokines interleukin-1? through nuclear factor-?B activation.
21442621 2011 Implication of human nonmetastatic clone 23 Type 1 and its downstream gene lipocalin 2 in metastasis and patient's survival of cancer of uterine cervix.
21439274 2011 Significant elevation and correlation of plasma neutrophil gelatinase associated lipocalin and its complex with matrix metalloproteinase-9 in patients with pelvic inflammatory disease.
21420718 2011 Neutrophil gelatinase-associated lipocalin: a new prognostic marker in stage I colorectal carcinoma?
21412214 2011 Urinary neutrophil gelatinase-associated lipocalin distinguishes pre-renal from intrinsic renal failure and predicts outcomes.
21403867 2010 Both IL-1? and TNF-? regulate NGAL expression in polymorphonuclear granulocytes of chronic hemodialysis patients.
21334721 2011 Laser-captured microdissection-microarray analysis of the genes involved in endometrial carcinogenesis: stepwise up-regulation of lipocalin2 expression in normal and neoplastic endometria and its functional relevance.
21307379 2011 Glomerular and tubular damage markers are elevated in patients with diabetes.
21300375 2011 Neutrophil gelatinase-associated lipocalin concentrations predict development of acute kidney injury in neonates and children after cardiopulmonary bypass.
21278918 2011 Lipocalin-2-induced cytokine production enhances endometrial carcinoma cell survival and migration.
21273640 2011 The role of lipocalin 2 and its concernment with human nonmetastatic clone 23 type 1 and p53 in carcinogenesis of uterine cervix.
21269460 2011 Initial characterization of the human central proteome.
21257679 2011 Urinary neutrophil gelatinase-associated lipocalin as a marker of acute kidney injury after orthotopic liver transplantation.
21184133 2011 NGAL and NGALR are frequently overexpressed in human gliomas and are associated with clinical prognosis.
21160226 2011 Urinary neutrophil gelatinase-associated lipocalin and progression of diabetic nephropathy in type 1 diabetic patients in a four-year follow-up study.
21150136 2010 Increased urinary lipocalin-2 reflects matrix metalloproteinase-9 activity in chronic hepatitis C with hepatic fibrosis.
21143924 2010 The effects of obesity and polycystic ovary syndrome on serum lipocalin-2 levels: a cross-sectional study.
21133718 2011 Increased serum levels of neutrophil gelatinase-associated lipocalin in patients with essential thrombocythemia and polycythemia vera.
21132267 2011 Inhibition of the proliferation and invasion of hepatocellular carcinoma cells by lipocalin 2 through blockade of JNK and PI3K/Akt signaling.
21115620 2011 Neutrophil gelatinase-associated lipocalin in the diagnosis of type 1 cardio-renal syndrome in the general ward.
21104585 2011 The lipocalins retinol-binding protein-4, lipocalin-2 and lipocalin-type prostaglandin D2-synthase correlate with markers of inflammatory activity, alcohol intake and blood lipids, but not with insulin sensitivity in metabolically healthy 58-year-old Swedish men.
21048034 2011 Upregulation of lipocalin-2 in human papillomavirus-positive keratinocytes and cutaneous squamous cell carcinomas.
21031541 2010 Neutrophil gelatinase--associated lipocalin predicts acute kidney injury in patients undergoing liver transplantation.
21030534 2011 Molecular MRI of murine atherosclerotic plaque targeting NGAL: a protein associated with unstable human plaque characteristics.
20961744 2011 Up-regulation of the novel proinflammatory adipokines lipocalin-2, chitinase-3 like-1 and osteopontin as well as angiogenic-related factors in visceral adipose tissue of patients with colon cancer.
20960272 2010 Disease and gender-specific dysregulation of NGAL and MMP-9 in type 1 diabetes mellitus.
20921623 2010 Lipocalin 2 is essential for chronic kidney disease progression in mice and humans.
20870707 2010 Weight loss in prepubertal obese children is associated with a decrease in adipocyte fatty-acid-binding protein without changes in lipocalin-2: a 2-year longitudinal study.
20853162 2011 Neutrophil gelatinase-associated lipocalin (NGAL) and matrix metalloproteinases as novel stress markers in children and young adults on chronic dialysis.
20819195 2011 Molecular biomarker candidates of acute kidney injury in zero-hour renal transplant needle biopsies.
20802417 2010 Kidney function assessed by eGFR, cystatin C and NGAL (neutrophil gelatinase-associated lipocalin) in relation to age in heart allograft recipients.
20703446 2010 Day/night variations of high-molecular-weight adiponectin and lipocalin-2 in healthy men studied under fed and fasted conditions.
20680102 2010 Aqueous humor neutrophil gelatinase-associated lipocalin levels in patients with idiopathic acute anterior uveitis.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20620526 2010 Serum neutrophil gelatinase-associated lipocalin correlates with kidney function in heart allograft recipients.
20596614 2010 Neutrophil gelatinase-associated lipocalin immunoexpression in renal tumors: correlation with histotype and histological grade.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20559153 2010 Genetic determinants of pemetrexed responsiveness and nonresponsiveness in non-small cell lung cancer cells.
20551266 2010 Up-regulation of lipocalin 2 is associated with high-risk human papillomavirus and grade of cervical lesion at baseline but does not predict outcomes of infections or incident cervical intraepithelial neoplasia.
20527084 2009 Implication of granulocyte-macrophage colony-stimulating factor induced neutrophil gelatinase-associated lipocalin in pathogenesis of rheumatoid arthritis revealed by proteome analysis.
20512104 2010 Neutrophil gelatinase-associated lipocalin (NGAL): a new piece of the anemia puzzle?
20511727 2011 Serum lipocalin-2 as an insulin resistance marker in patients with polycystic ovary syndrome.
20504881 2010 Parenteral iron formulations differentially affect MCP-1, HO-1, and NGAL gene expression and renal responses to injury.
20504246 2011 Plasma lipocalin-2 levels in pregnant women with pre-eclampsia, and their relation with severity of disease.
20502037 2010 Neutrophil gelatinase-associated lipocalin and hepcidin: what do they have in common and is there a potential interaction?
20496473 2010 Urinary neutrophil gelatinase-associated lipocalin is a promising biomarker for late onset culture-positive sepsis in very low birth weight infants.
20435938 2010 Plasma neutrophil gelatinase-associated lipocalin and acute postoperative kidney injury in adult cardiac surgical patients.
20412947 2010 Neutrophil gelatinase-associated lipocalin: a promising biomarker for detecting cardiac surgery-associated acute kidney injury.
20373132 2010 NGAL knockdown by siRNA in human cholangiocarcinoma cells suppressed invasion by reducing NGAL/MMP-9 complex formation.
20363104 2010 Neutrophil gelatinase associated lipocalin as a biomarker for acute kidney injury in patients undergoing coronary artery bypass grafting with cardiopulmonary bypass.
20306447 Serum neutrophil gelatinase-associated lipocalin in patients with colorectal liver metastases: preliminary results of an exploratory prospective study.
20208456 2010 Serum levels of the adipokine lipocalin-2 are increased in preeclampsia.
20179686 2010 Elevated serum neutrophil gelatinase-associated lipocalin is an early predictor of severity and outcome in acute pancreatitis.
20123318 2010 Serum neutrophil gelatinase-associated lipocalin (NGAL) in predicting worsening renal function in acute decompensated heart failure.
20101218 2010 NFAT3 transcription factor inhibits breast cancer cell motility by targeting the Lipocalin 2 gene.
20086155 2010 Neutrophil gelatinase-associated lipocalin expresses antimicrobial activity by interfering with L-norepinephrine-mediated bacterial iron acquisition.
20072790 2010 Neutrophil gelatinase-associated lipocalin (NGAL): a new marker of cyclosporine nephrotoxicity?
20068352 2009 Neutrophil gelatinase-associated lipocalin in dialyzed patients is related to residual renal function, type of renal replacement therapy and inflammation.
20057160 2010 Lipocalin-2/neutrophil gelatinase-B associated lipocalin is strongly induced in hearts of rats with autoimmune myocarditis and in human myocarditis.
20056755 2010 Neutrophil gelatinase-associated lipocalin and acute kidney injury after cardiac surgery: the effect of baseline renal function on diagnostic performance.
20030526 2009 Urinary and serum biomarkers after cardiac catheterization in diabetic patients with stable angina and without severe chronic kidney disease.
19951994 2009 Upregulation of neutrophil gelatinase-associated lipocalin by ErbB2 through nuclear factor-kappaB activation.
19938135 2009 Acute kidney injury during liver transplantation as determined by neutrophil gelatinase-associated lipocalin.
19904630 2010 Neutrophil gelatinase-associated lipocalin induces the expression of heme oxygenase-1 and superoxide dismutase 1, 2.
19889214 2009 Circulating levels of matrix metalloproteinase-9 (MMP-9), neutrophil gelatinase-associated lipocalin (NGAL) and their complex MMP-9/NGAL in breast cancer disease.
19887608 2009 Inhibition of lipocalin 2 impairs breast tumorigenesis and metastasis.
19875582 2009 Adipocytokines and insulin resistance: the possible role of lipocalin-2, retinol binding protein-4, and adiponectin.
19863663 2010 Siderocalin inhibits the intracellular replication of Mycobacterium tuberculosis in macrophages.
19857721 2009 Plasma neutrophil gelatinase-associated lipocalin (NGAL) correlations with cystatin C, serum creatinine, and glomerular filtration rate in patients after heart and lung transplantation.
19850388 2009 Accuracy of neutrophil gelatinase-associated lipocalin (NGAL) in diagnosis and prognosis in acute kidney injury: a systematic review and meta-analysis.
19732769 2009 Lipocalin 2 regulation by thermal stresses: protective role of Lcn2/NGAL against cold and heat stresses.
19727808 2009 Neutrophil gelatinase-associated lipocalin (NGAL/Lcn2) is upregulated in gastric mucosa infected with Helicobacter pylori.
19714584 2009 Neutrophil gelatinase-associated lipocalin is a predictor of the course of global and renal childhood-onset systemic lupus erythematosus disease activity.
19708926 Serum neutrophil gelatinase-associated lipocalin correlates with kidney function in renal allograft recipients.
19680166 2009 Reference values of urinary neutrophil gelatinase-associated lipocalin in very low birth weight infants.
19661117 2009 Neutrophil gelatinase-associated lipocalin levels after use of mini-cardiopulmonary bypass system.
19649660 2009 Early prediction of urinary tract infection with urinary neutrophil gelatinase associated lipocalin.
19638718 2009 [Novel biological involvements of siderophore-binding proteins in hematopoiesis, cell differentiation, tissue injury, carcinogenesis and infections].
19549696 2009 Neutrophil gelatinase-associated lipocalin (NGAL) reflects iron status in haemodialysis patients.
19540040 2010 Neutrophil gelatinase-associated lipocalin (NGAL) in human neoplasias: a new protein enters the scene.
19474273 2009 The predictive performance of plasma neutrophil gelatinase-associated lipocalin (NGAL) increases with grade of acute kidney injury.
19466389 2009 Increased adipose tissue expression of lipocalin-2 in obesity is related to inflammation and matrix metalloproteinase-2 and metalloproteinase-9 activities in humans.
19454345 2009 A precious metal heist.
19419554 2009 Clinical significance of Neutrophil gelatinase-associated lipocalin(NGAL) expression in primary rectal cancer.
19342674 2009 Lipocalin 2 is required for pulmonary host defense against Klebsiella infection.
19321980 2009 Neutrophil gelatinase-associated lipocalin as an early biomarker of nephropathy in diabetic patients.
19308044 2009 NGAL decreases E-cadherin-mediated cell-cell adhesion and increases cell motility and invasion through Rac1 in colon carcinoma cells.
19287180 2009 Serum neutrophil gelatinase-associated lipocalin as a marker of renal function in patients with chronic heart failure and coronary artery disease.
19249502 Neutrophil gelatinase-associated lipocalin is a new and sensitive marker of kidney function in chronic kidney disease patients and renal allograft recipients.
19249501 Neutrophil gelatinase-associated lipocalin and cystatin C could predict renal outcome in patients undergoing kidney allograft transplantation: a prospective study.
19237579 2009 Lipocalin 2 promotes breast cancer progression.
19229297 2009 Transcription and signalling pathways involved in BCR-ABL-mediated misregulation of 24p3 and 24p3R.
19201208 2009 A comparison of urinary neutrophil gelatinase-associated lipocalin in patients undergoing on- versus off-pump coronary artery bypass graft surgery.
19176795 2009 Neutrophil gelatinase-associated lipocalin (NGAL) and progression of chronic kidney disease.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19148711 2009 Roles of neutrophil gelatinase-associated lipocalin in continuous ambulatory peritoneal dialysis-related peritonitis.
19148153 2009 Urinary neutrophil gelatinase-associated lipocalin levels reflect damage to glomeruli, proximal tubules, and distal nephrons.
19092815 2009 Elevated urine neutrophil gelatinase-associated lipocalin can diagnose acute kidney injury in patients with chronic kidney diseases.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19055468 2009 Urinary neutrophil gelatinase-associated lipocalin (NGAL) as an early marker of acute kidney injury in critically ill multiple trauma patients.
19015448 2008 Expression of neutrophil gelatinase-associated lipocalin in nasal polyps.
18927283 2008 Expression analysis of Barrett's esophagus-associated high-grade dysplasia in laser capture microdissected archival tissue.
18852336 2009 Ex vivo and in vivo regulation of lipocalin-2, a novel adipokine, by insulin.
18809975 2008 Neutrophil gelatinase-associated lipocalin--an emerging troponin for kidney injury.
18803290 2008 Relationship of SNCG, S100A4, S100A9 and LCN2 gene expression and DNA methylation in bladder cancer.
18798264 2008 Identification of new accessible tumor antigens in human colon cancer by ex vivo protein biotinylation and comparative mass spectrometry analysis.
18768801 2008 The neutrophil gelatinase-associated lipocalin (NGAL), a NF-kappaB-regulated gene, is a survival factor for thyroid neoplastic cells.
18753796 2008 Pathological and prognostic value of urinary neutrophil gelatinase-associated lipocalin in macroproteinuric patients with worsening renal function.
18710473 2009 Effect of exercise training on A-FABP, lipocalin-2 and RBP4 levels in obese women.
18676832 2008 Neutrophil gelatinase-associated lipocalin: a novel suppressor of invasion and angiogenesis in pancreatic cancer.
18663364 2008 Lipocalin 2 is required for BCR-ABL-induced tumorigenesis.
18600028 2008 Neutrophil gelatinase-associated lipocalin reflects the severity of renal impairment in subjects affected by chronic kidney disease.
18464118 2008 Neutrophil gelatinase-associated lipocalin expression in chronic myeloid leukemia.
18437016 2008 Expression of neutrophil gelatinase-associated lipocalin in calcium-induced keratinocyte differentiation.
18398717 2008 Requirement of lipocalin 2 for chronic myeloid leukemia.
18393169 2008 Lipocalin-2: development, analytical characterization, and clinical testing of a new ELISA.
18392050 2008 Early diagnosis of pancreatic cancer: neutrophil gelatinase-associated lipocalin as a marker of pancreatic intraepithelial neoplasia.
18375251 2008 Upregulation of neutrophil gelatinase-associated lipocalin, NGAL/Lcn2, in beta-thalassemia patients.
18362300 2008 Serum concentrations of atherogenic proteins neutrophil gelatinase-associated lipocalin and its complex with matrix metalloproteinase-9 are significantly lower in women with polycystic ovary syndrome: hint of a protective mechanism?
18337554 2008 Urine NGAL predicts severity of acute kidney injury after cardiac surgery: a prospective study.
18317594 2008 Neutrophil gelatinase-associated lipocalin mediates 13-cis retinoic acid-induced apoptosis of human sebaceous gland cells.
18287807 2008 Urinary IL-18 and NGAL as early predictive biomarkers in contrast-induced nephropathy after coronary angiography.
18275504 2008 Serum neutrophil gelatinase-associated lipocalin as a marker of renal function in hypertensive and normotensive patients with coronary artery disease.
18070344 2007 Plasma neutrophil gelatinase-associated lipocalin predicts acute kidney injury, morbidity and mortality after pediatric cardiac surgery: a prospective uncontrolled cohort study.
18064607 2008 Lipocalin 2-mediated growth suppression is evident in human erythroid and monocyte/macrophage lineage cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18001501 2007 N-GAL: diagnosing AKI as soon as possible.
17949711 2007 Co-expression by keratinocytes of migration stimulating factor (MSF) and a functional inhibitor of its bioactivity (MSFI).
17907186 2007 Neutrophil gelatinase-associated lipocalin is expressed in osteoarthritis and forms a complex with matrix metalloproteinase 9.
17901710 2007 Could neutrophil-gelatinase-associated lipocalin and cystatin C predict the development of contrast-induced nephropathy after percutaneous coronary interventions in patients with stable angina and normal serum creatinine values?
17874137 2007 NGAL is an early predictive biomarker of contrast-induced nephropathy in children.
17847728 2007 Expression of neutrophil gelatinase-associated lipocalin in human salivary glands.
17721627 2007 Presence of NGAL/MMP-9 complexes in human abdominal aortic aneurysms.
17570904 2007 Neutrophil gelatinase-associated lipocalin in patients with autosomal-dominant polycystic kidney disease.
17554627 2008 Neutrophil gelatinase-associated lipocalin (NGAL) is a predictor of poor prognosis in human primary breast cancer.
17530720 2007 Urinary lipocalin-2 is associated with renal disease activity in human lupus nephritis.
17360238 2007 Urinary neutrophil gelatinase-associated lipocalin (NGAL) is an early biomarker for renal tubulointerstitial injury in IgA nephropathy.
17294443 2007 Neutrophil gelatinase-associated lipocalin (NGAL) an early-screening biomarker for ovarian cancer: NGAL is associated with epidermal growth factor-induced epithelio-mesenchymal transition.
17253959 2007 A novel alternative spliced variant of neutrophil gelatinase-associated lipocalin receptor in oesophageal carcinoma cells.
17229907 2007 Dual action of neutrophil gelatinase-associated lipocalin.
17114340 2006 Lipocalin 2 antagonizes the proangiogenic action of ras in transformed cells.
16827865 2006 Urine NGAL and IL-18 are predictive biomarkers for delayed graft function following kidney transplantation.
16798734 2006 Identification of common transcriptional regulatory elements in interleukin-17 target genes.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16733850 2006 Identification of biomarkers of human pancreatic adenocarcinomas by expression profiling and validation with gene expression analysis in endoscopic ultrasound-guided fine needle aspiration samples.
16671099 2006 Regulation of lipocalin-2 gene by the cancer chemopreventive retinoid 4-HPR.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16381001 2006 Ectopic expression of neutrophil gelatinase-associated lipocalin suppresses the invasion and liver metastasis of colon cancer cells.
16374475 2006 Expression of neutrophil gelatinase-associated lipocalin in skin epidermis.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16254208 2006 Expression of neutrophil gelatinase-associated lipocalin in atherosclerosis and myocardial infarction.
16146540 2005 On mouse and man: neutrophil gelatinase associated lipocalin is not involved in apoptosis or acute response.
16061852 2005 The matrix metalloproteinase-9/neutrophil gelatinase-associated lipocalin complex plays a role in breast tumor growth and is present in the urine of breast cancer patients.
16060857 2005 Neutrophil gelatinase-associated lipocalin as a survival factor.
15711640 2005 Endocytic delivery of lipocalin-siderophore-iron complex rescues the kidney from ischemia-reperfusion injury.
15691834 2005 Lipocalin 2 diminishes invasiveness and metastasis of Ras-transformed cells.
15670845 2005 The endocytic receptor megalin binds the iron transporting neutrophil-gelatinase-associated lipocalin with high affinity and mediates its cellular uptake.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15084671 2004 A proteomic analysis of human bile.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473066 2002 Neutrophil gelatinase-associated lipocalin is a marker for dysregulated keratinocyte differentiation in human skin.
12453413 2002 An iron delivery pathway mediated by a lipocalin.
12453412 2002 The neutrophil lipocalin NGAL is a bacteriostatic agent that interferes with siderophore-mediated iron acquisition.
11986950 2002 Potential involvement of the AML1-MTG8 fusion protein in the granulocytic maturation characteristic of the t(8;21) acute myelogenous leukemia revealed by microarray analysis.
11486081 2001 Induction of apoptosis by a secreted lipocalin that is transcriptionally regulated by IL-3 deprivation.
10777108 2000 Expression of NRL/NGAL (neu-related lipocalin/neutrophil gelatinase-associated lipocalin) during mammalian embryonic development and in inflammation.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10684642 2000 Ligand preference inferred from the structure of neutrophil gelatinase associated lipocalin.
10529240 1999 Glycosylation of natural human neutrophil gelatinase B and neutrophil gelatinase B-associated lipocalin.
10475571 1999 Neutrophil gelatinase-associated lipocalin in normal and neoplastic human tissues. Cell type-specific pattern of expression.
10339412 1999 The solution structure and dynamics of human neutrophil gelatinase-associated lipocalin.
9842963 1998 Heterogeneous expression of the lipocalin NGAL in primary breast cancers.
9339356 1997 Molecular characterization and pattern of tissue expression of the gene for neutrophil gelatinase-associated lipocalin from humans.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8633182 1995 Studies of the release and turnover of a human neutrophil lipocalin.
8195592 1994 The development of an assay for human neutrophil lipocalin (HNL)--to be used as a specific marker of neutrophil activity in vivo and vitro.
8060329 1994 Molecular cloning and expression of a cDNA encoding NGAL: a lipocalin expressed in human neutrophils.
7997842 1994 Purification and characterization of a human neutrophil lipocalin (HNL) from the secondary granules of human neutrophils.
7835423 1995 Cloning and expression of human neutrophil lipocalin cDNA derived from bone marrow and ovarian cancer cells.
7829063 1994 Comparative mapping of lipocalin genes in human and mouse: the four genes for complement C8 gamma chain, prostaglandin-D-synthase, oncogene-24p3, and progestagen-associated endometrial protein map to HSA9 and MMU2.
7683678 1993 Isolation and primary structure of NGAL, a novel protein associated with human neutrophil gelatinase.
7554268 1995 A sandwich enzyme immunoassay for the determination of neutrophil lipocalin in body fluids.
1281792 1992 A 25 kDa alpha 2-microglobulin-related protein is a component of the 125 kDa form of human gelatinase.