Property Summary

NCBI Gene PubMed Count 561
PubMed Score 2368.12
PubTator Score 1235.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

PDB (46)

Gene RIF (528)

AA Sequence

MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQK      1 - 70
MYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAM     71 - 140
VFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG                141 - 198
//

Text Mined References (568)

PMID Year Title