Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.97
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.6e-04
Disease Target Count Z-score Confidence
Friedreich ataxia 24 3.547 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.034 1.6e-04

AA Sequence

MMSFLLGAILTLLWAPTAQAEVLLQPDFNAEKFSGLWYVVSMASDCRVFLGKKDHLSMSTRAIRPTEEGG      1 - 70
LHVHMEFPGADGCNQVDAEYLKVGSEGHFRVPALGYLDVRIVDTDYSSFAVLYIYKELEGALSTMVQLYS     71 - 140
RTQDVSPQALKSFQDFYPTLGLPKDMMVMLPQSDACNPESKEAP                              141 - 184
//

Text Mined References (4)

PMID Year Title