Property Summary

NCBI Gene PubMed Count 39
PubMed Score 221.27
PubTator Score 99.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Dry eye syndrome 18 4.028 2.0

Expression

Gene RIF (22)

AA Sequence

MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAK      1 - 70
VTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKN     71 - 140
NLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD                                      141 - 176
//

Text Mined References (41)

PMID Year Title