Property Summary

NCBI Gene PubMed Count 38
PubMed Score 218.55
PubTator Score 99.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Dry eye syndrome 14 3.887 1.9

Expression

Synonym

Accession P31025 Q5T8A1
Symbols TP
TLC
PMFA
VEGP

Gene

PANTHER Protein Class (1)

PDB

4QAF   1XKI   3EYC  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (22)

PMID Text
26366224 the possible relationship between ocular symptomatology, tear volume and tear break-up time (TBUT) and lipocalin, lactoferrin and lysozyme concentrations in the tear film were explored in a group of symptomatic dry-eyed postmenopausal (PM) women.
26218644 the crosstalk of dendritic cells with lipocalins alone has the potential to direct the type of immune response to these particular antigens.
26135974 Human neutrophil lipocalin (HNL) concentrations in serum or whole blood activated by formyl-methionine-leucine-phenylalanine (fMLP) were shown to distinguish acute infections of bacterial or viral cause with high accuracy.
25914748 Tear lysozyme, lactoferrin and lipocalin concentrations were determined via electrophoresis and the results for patients with or without eyelid tumors were compared.
24920892 Serum concentrations of LCN1 and LCN2 were both elevated in patients with COPD.
21791187 Tear lipocalin (TLC) is a major protein in tears and has a large ligand-binding cavity that allows the lipocalin to bind an extensive and diverse set of lipophilic molecules.
21466861 The conserved disulfide bond of human tear lipocalin modulates conformation and lipid binding in a ligand selective manner.(
21324447 Study has identified the first protein, lipocalin-1, in the secretome of human blastocysts that is associated with chromosome aneuploidy.
19770509 Tear lipocalin with the bound artificial ligand 1,4-butanediol has been crystallized in space group P2(1) with four protein molecules in the asymmetric unit and its X-ray structure has been solved at 2.6 A resolution.
19586017 Results suggest that the excited protein states in tear lipocalin are not unique but consist of many substates.
18334931 Tear lipocalin is the principal endonuclease in human tear fluid.
17945179 Selective displacement of ANS molecules from the ANS-apoTL complex by stearic acid discriminates the internal and external binding sites.
17869594 Hydrodynamic and solution properties of lipocalin from human tears show that the protein size and topology are the major determinants of rotational correlation time and a reason for deviation from the Stokes-Einstein relationship.
16249071 Lipocalin is a novel autoantigen target in Sjogren's syndrome.
15489503 structural analysis sheds new light on the ligand binding activity of this functionally obscure but abundant human lipocalin
15461462 pH-driven ligand release involves ionization changes in several titratable residues associated with CD and EF loop apposition and occlusion of the calyx
12613963 Tear surface tension depends partly on presence of tear lipocalin/lipid complex. Tear proteins and lipid-free tear lipocalin lower surface tension.
12613961 Tear lipocalin is probable protein carrier for vitamin E tears and is candidate to specifically deliver vitamin E as antioxidant to corneal epithelium.
12613960 structure, function, and mechanism of action [review]
12591932 LIMR mediating internalization of lipocalin-1 (Lcn-1) in NT2 cells, leading to its degradation.
11850445 Lcn-1 is specifically produced by corticotrophs
11727836 The N-terminal part of recombinant human tear lipocalin/von Ebner's gland protein confers cysteine proteinase inhibition depending on the presence of the entire cystatin-like sequence motifs.

AA Sequence

MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAK      1 - 70
VTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKN     71 - 140
NLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD                                      141 - 176
//

Text Mined References (40)

PMID Year Title
26366224 2015 Tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
26218644 2015 Allergenic Can f 1 and its human homologue Lcn-1 direct dendritic cells to induce divergent immune responses.
26135974 2015 Human Neutrophil Lipocalin as a Superior Diagnostic Means To Distinguish between Acute Bacterial and Viral Infections.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25914748 Correlations between eyelid tumors and tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
24920892 2014 Increased serum levels of lipocalin-1 and -2 in patients with stable chronic obstructive pulmonary disease.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21791187 2011 Tear lipocalin: structure and function.
21466861 2011 The conserved disulfide bond of human tear lipocalin modulates conformation and lipid binding in a ligand selective manner.
21324447 2011 Lipocalin-1: a potential marker for noninvasive aneuploidy screening.
19770509 2009 A new crystal form of human tear lipocalin reveals high flexibility in the loop region and induced fit in the ligand cavity.
19586017 2009 Intracavitary ligand distribution in tear lipocalin by site-directed tryptophan fluorescence.
18334931 2008 Tear lipocalin is the major endonuclease in tears.
17945179 2007 Evidence for internal and external binding sites on human tear lipocalin.
17869594 2007 Oligomeric state of lipocalin-1 (LCN1) by multiangle laser light scattering and fluorescence anisotropy decay.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16249071 2005 Identification of tear lipocalin as a novel autoantigen target in Sjögren's syndrome.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15489503 2005 The 1.8-A crystal structure of human tear lipocalin reveals an extended branched cavity with capacity for multiple ligands.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461462 2004 Interstrand loops CD and EF act as pH-dependent gates to regulate fatty acid ligand binding in tear lipocalin.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12613963 2002 The role of lipocalin in determining the physical properties of tears.
12613961 2002 Vitamin E associated with the lipocalin fraction of human tears.
12613960 2002 Tear lipocalin: structure, function and molecular mechanisms of action.
12591932 2003 Antisense down-regulation of lipocalin-interacting membrane receptor expression inhibits cellular internalization of lipocalin-1 in human NT2 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11287427 2001 Molecular cloning of a novel lipocalin-1 interacting human cell membrane receptor using phage display.
10558865 1999 Interaction of tear lipocalin with lysozyme and lactoferrin.
9759656 1998 Identification of a lipocalin in mucosal glands of the human tracheobronchial tree and its enhanced secretion in cystic fibrosis.
8999869 1997 The salivary lipocalin von Ebner's gland protein is a cysteine proteinase inhibitor.
8898072 1996 Expression of the gene for tear lipocalin/von Ebner's gland protein in human prostate.
8500570 1993 Cloning of a human lacrimal lipocalin secreted in tears.
8276406 1993 Assignment of the human tear lipocalin gene (LCN1) to 9q34 by in situ hybridization.
8112601 1994 Structural organization of the gene encoding the human lipocalin tear prealbumin and synthesis of the recombinant protein in Escherichia coli.
7679926 1993 Molecular cloning of human von Ebner's gland protein, a member of the lipocalin superfamily highly expressed in lingual salivary glands.
7606920 1995 Assignment of LCN1 to human chromosome 9 is confirmed.
1400345 1992 cDNA cloning and sequencing reveals human tear prealbumin to be a member of the lipophilic-ligand carrier protein superfamily.