Property Summary

NCBI Gene PubMed Count 374
PubMed Score 1500.26
PubTator Score 874.30

Knowledge Summary

Patent (102,421)

TINX Plot

  Disease (7)

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis 1.200 1.5e-02
Chronic Lymphocytic Leukemia 1.775 7.3e-04
cutaneous lupus erythematosus 2.400 5.8e-04
interstitial cystitis 1.700 1.5e-03
osteosarcoma -2.736 5.9e-06
primary Sjogren syndrome 1.600 3.0e-03
psoriasis 1.300 3.0e-03
sarcoidosis 1.100 3.8e-02
ulcerative colitis 1.700 1.5e-05

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (219)

AA Sequence

MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALH      1 - 70
SYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQ     71 - 140
LLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYT    141 - 210
NASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSM    211 - 280
SPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAE    281 - 350
GMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK    351 - 420
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYL    421 - 490
RSVLEDFFTATEGQYQPQP                                                       491 - 509
//

Text Mined References (398)

PMID Year Title