Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MSCQQNQQQCQPPPKCPIPKYPPKCPSKCASSCPPPISSCCGSSSGGCGCCSSEGGGCCLSHHRHHRSHC      1 - 70
HRPKSSNCYGSGSGQQSGGSGCCSGGGCC                                              71 - 99
//

Text Mined References (7)

PMID Year Title