Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 4.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
periodontitis 280 8.2e-15
Atopic dermatitis 915 1.2e-05
diabetes mellitus 1683 1.5e-03
Disease Target Count Z-score Confidence
Irritant dermatitis 9 4.331 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis -4.400 1.2e-05
diabetes mellitus 1.600 1.5e-03
periodontitis -1.100 8.2e-15

Gene RIF (2)

AA Sequence

MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSSGGCCNSGAGG      1 - 70
CCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC                                   71 - 110
//

Text Mined References (6)

PMID Year Title